Natrinema pellirubrum: Natpe_0675 Help Entry Natpe_0675        CDS       T02425                                  Name (GenBank) ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism npe  Natrinema pellirubrum Pathway npe03010   Ribosome Brite KEGG Orthology (KO) [BR:npe00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Natpe_0675   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Natpe_0675  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:npe03011]     Natpe_0675    04121 Ubiquitin system [BR:npe04121]     Natpe_0675   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npe04147]     Natpe_0675 Ribosome [BR:npe03011]  Ribosomal proteins   Eukaryotes    Small subunit     Natpe_0675   Archaea     Natpe_0675 Ubiquitin system [BR:npe04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Natpe_0675 Exosome [BR:npe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Natpe_0675   Exosomal proteins of colorectal cancer cells    Natpe_0675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 Zn_ribbon_Nudix Tad3 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  AGB30599 UniProt:  L0JH04 LinkDB All DBs Position 665330..665464 Genome browser AA seq 44 aa AA seqDB search MARYELYNDDGSTEREQCPRCGDVFLADHGDRKHCGKCSYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggctcgctacgaactctacaacgacgatgggagtacggagcgcgaacagtgcccccgc tgcggtgacgtgttcctcgccgaccacggcgaccgcaagcactgcgggaagtgcagttac accgagtgggagtaa

DBGET integrated database retrieval system