KEGG   Natrinema pellirubrum: Natpe_1744
Entry
Natpe_1744        CDS       T02425                                 
Name
(GenBank) response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
npe  Natrinema pellirubrum
Pathway
npe02020  Two-component system
npe02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:npe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Natpe_1744
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Natpe_1744
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:npe02022]
    Natpe_1744
   02035 Bacterial motility proteins [BR:npe02035]
    Natpe_1744
Two-component system [BR:npe02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Natpe_1744
Bacterial motility proteins [BR:npe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Natpe_1744
SSDB
Motif
Pfam: Response_reg DUF5880
Other DBs
NCBI-ProteinID: AGB31633
UniProt: L0JLA2
LinkDB
Position
1709133..1709336
AA seq 67 aa
MMPEMDGFSVLDRIRENGEMQEISVIMLTSRSREEDIVRALEAGADDFLAKPFNKSELYG
RVQQTLQ
NT seq 204 nt   +upstreamnt  +downstreamnt
atgatgccagagatggatgggttttcggtcttggatcgcatcagagagaacggtgaaatg
caggagatttcagttattatgctgacgtctcggagtcgggaggaagacatcgttcgagcg
cttgaggcaggtgcggacgatttcttggctaagccattcaacaaatccgaactatacgga
cgggtacagcaaacactccagtga

DBGET integrated database retrieval system