Neisseria perflava: LPB400_02895 Help Entry LPB400_02895      CDS       T07577                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism npf  Neisseria perflava Pathway npf01100   Metabolic pathways npf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:npf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LPB400_02895    00074 Mycolic acid biosynthesis     LPB400_02895   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LPB400_02895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QXW90996 LinkDB All DBs Position 568797..569087 Genome browser AA seq 96 aa AA seqDB search MSYTFTLAEHELEAELKKLIVQEADKADDVDMDDFTDDALLFGDDSPVGLDSLDALQISV ALQQYFQVRLQGDRMVRKHMMCVRDLAAFIRAEHGA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtcttacacctttacgctggccgagcacgagctggaagcggaattgaaaaagctaatc gtgcaagaggccgataaggccgacgatgtggatatggatgatttcaccgacgatgcactt ttgtttggcgatgacagtccggtcggtttggattcgcttgatgcgctgcaaatcagcgtt gccttgcaacagtatttccaagtgcgcctgcagggcgaccgtatggtgcgcaaacatatg atgtgcgtacgcgatttggcggcgtttatccgtgcggagcatggcgcgtga

DBGET integrated database retrieval system