Natronomonas pharaonis: NP_0094A Help Entry NP_0094A          CDS       T00279                                  Symbol rpl40e Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism nph  Natronomonas pharaonis Pathway nph03010   Ribosome Brite KEGG Orthology (KO) [BR:nph00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NP_0094A (rpl40e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NP_0094A (rpl40e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nph03011]     NP_0094A (rpl40e)    04121 Ubiquitin system [BR:nph04121]     NP_0094A (rpl40e) Ribosome [BR:nph03011]  Ribosomal proteins   Eukaryotes    Large subunit     NP_0094A (rpl40e)   Archaea     NP_0094A (rpl40e) Ubiquitin system [BR:nph04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NP_0094A (rpl40e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-CHY DZR_2 DHHC Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  CAI48138 UniProt:  Q3IUP2 LinkDB All DBs Position complement(39868..40017) Genome browser AA seq 49 aa AA seqDB search MASFEEAEERILDKMICMRCNARNPKRADSCRKCGYKKLRPKAKERRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctagcttcgaggaggcagaagagcgcattctcgacaagatgatttgtatgcgctgc aacgcccgcaacccgaaacgtgccgacagctgccggaagtgcggatacaagaagcttcgc cccaaggcgaaggaacgccgcgcggcctaa

DBGET integrated database retrieval system