Natronomonas pharaonis: NP_5072A Help Entry NP_5072A          CDS       T00279                                  Symbol rps31e Name (GenBank) 30S ribosomal protein S31e   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism nph  Natronomonas pharaonis Pathway nph03010   Ribosome Brite KEGG Orthology (KO) [BR:nph00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NP_5072A (rps31e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NP_5072A (rps31e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:nph03011]     NP_5072A (rps31e)    04121 Ubiquitin system [BR:nph04121]     NP_5072A (rps31e)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:nph04147]     NP_5072A (rps31e) Ribosome [BR:nph03011]  Ribosomal proteins   Eukaryotes    Small subunit     NP_5072A (rps31e)   Archaea     NP_5072A (rps31e) Ubiquitin system [BR:nph04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NP_5072A (rps31e) Exosome [BR:nph04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NP_5072A (rps31e)   Exosomal proteins of colorectal cancer cells    NP_5072A (rps31e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_19 zf-C2H2_FBX41 Phage_zn_bind_3 Zn_ribbon_RPB9 Motif Other DBs NCBI-ProteinID:  CAI50627 UniProt:  A0A1U7EZA7 LinkDB All DBs Position complement(2464097..2464231) Genome browser AA seq 44 aa AA seqDB search MARYEFYNEDGTTDREQCPRCGDTFLGEYGDRKHCGKCSYTEFQ NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgctacgagttctacaacgaggacggcacgacggaccgcgagcagtgtccccgc tgtggcgacaccttcctcggtgagtacggcgaccgcaagcactgcggcaagtgcagctac accgagttccagtag

DBGET integrated database retrieval system