Nocardioides piscis: G7071_12045 Help Entry G7071_12045       CDS       T07459                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism npi  Nocardioides piscis Pathway npi01100   Metabolic pathways npi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:npi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7071_12045    00074 Mycolic acid biosynthesis     G7071_12045   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7071_12045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIK76055 UniProt:  A0A6G7YGW3 LinkDB All DBs Position complement(2438691..2438936) Genome browser AA seq 81 aa AA seqDB search MATTEEIRTDLAEIVNEVAGIPADDVQLDKSFVDDLDVDSLSMVEVVVAAEEKFGVTIPD DEVKNLKTVGDAVAFIERAQG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccaccaccgaagagatccgcaccgacctcgccgagatcgtcaacgaggtcgccggc atccccgccgacgacgtccagctcgacaagtctttcgtcgacgacctcgacgtcgactcg ctctccatggtcgaggtcgtcgtggccgccgaggagaagttcggcgtcaccatccccgac gacgaggtcaagaacctcaagaccgtcggcgacgcggtcgcgttcatcgagcgcgcacag ggctga

DBGET integrated database retrieval system