KEGG   Neorhizobium petrolearium: QEO92_21220
Entry
QEO92_21220       CDS       T09021                                 
Name
(GenBank) NADH-quinone oxidoreductase subunit NuoF
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
npm  Neorhizobium petrolearium
Pathway
npm00630  Glyoxylate and dicarboxylate metabolism
npm00680  Methane metabolism
npm01100  Metabolic pathways
npm01120  Microbial metabolism in diverse environments
npm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:npm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    QEO92_21220
  09102 Energy metabolism
   00680 Methane metabolism
    QEO92_21220
SSDB
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB SLBB_2
Other DBs
NCBI-ProteinID: WGI67485
UniProt: A0ABY8LYS9
LinkDB
Position
complement(4367374..4368930)
AA seq 518 aa
MTVAIFVPRDAAALALGAEKVAKAITQEIAARGLDAKVVRNGSRGMFWLEPLVEVRNGHG
RVAYGPVKASDVKGLFDAGFLTGGDHPLCLGLTKDIPFLRQQTRLTFSRCGVTDPVSLDD
YRQYQGLKGLEKALSMAPAEIVREVTDSGLRGRGGAGFPTGIKWKTVLDAAGPQKYIVCN
ADEGDSATFADRMIMEGDPFVLIEGMIIAGVATGATKGYVYIRSEYPHAIETMTEAVEIA
RVAGILGPSVMGSAHAFDMEIRSGAGAYVCGEETSLLNSLEGKRGIVRAKPPLPALKGFL
GRPTVVNNVISLASVPVIMDRGAAFYRDFGMGRSRGTIPIQIAGNVKYGGLYETAFGLSL
GEIVDHIGGGTASARPVKAVQVGGPLGAYFPRALFDTPFDYEAFAARDGLIGHAGITVFD
DTVDMLKQARFAMEFCAIESCGKCTPCRIGSTRGVETADKIAQGVEPEKNKALLADLCNT
MKFGSLCALGGFTPYPVMSAMNHFPEDFAPTPFIEAAE
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgacggtggcaatcttcgtgccgcgcgatgccgctgcgctcgcgctcggagccgaaaag
gtggcgaaggcgattacccaggagatcgcagcccgcggcctcgatgcgaaagtggtgcgc
aacggctcgcgcggcatgttctggctggagccgctcgtcgaggttcgcaatgggcatggc
cgtgtcgcctacggcccggtgaaggcgagcgatgtgaaaggcctatttgatgccggattc
ctgacgggcggcgatcatccgctctgtctcgggctgacgaaggatattccgttccttcgt
cagcaaacgcgtcttactttttcccggtgcggggttaccgatccggtttcccttgatgac
tatcggcagtatcaggggctgaagggactggaaaaagcgctctccatggctcctgccgag
atcgtcagggaagtcactgacagcggcctgcgcggacgtggtggagcgggcttcccgacc
ggcatcaaatggaagacggttctggatgcggccggtccgcagaaatacatcgtctgcaat
gccgacgaaggggacagtgcgacctttgccgaccgtatgatcatggagggcgatcccttc
gtgctgatcgaaggcatgatcattgcgggcgtcgcgaccggtgccaccaagggttatgtc
tatatccgttccgaatatccgcatgcgatcgagacgatgacggaggcggtcgagatcgcc
cgtgtcgccggtatcctcggaccgtcggtgatggggtcggcgcatgcgttcgacatggaa
atccgatcgggtgccggtgcctatgtctgcggcgaggagacctcgctcctcaattctctc
gaaggcaagcgggggatcgtgcgcgccaaaccgccgctgccggcattgaaggggttcctc
ggccgtccgaccgtggtcaacaatgtcatctcgcttgcttccgtgccggtcatcatggat
cggggggcggccttttatcgcgatttcggcatgggccggtcgcggggcacgatcccgatc
cagatcgccggcaatgtcaaatatggcgggctctacgagaccgctttcggcctgtcgctg
ggtgagatcgtcgatcatatcggcggcggcacggcaagcgcacggccggtaaaggcggtg
caggtgggcggcccgctgggcgcctatttcccacgtgctctgttcgatacgccgttcgat
tacgaagcctttgcggccagggacggattgatcggccatgcggggattaccgttttcgac
gacacggtggatatgctcaaacaggcgcggttcgcgatggaattctgcgccatcgaaagc
tgcggcaagtgtacgccgtgtcgtattggctcgacacggggcgtggaaacggccgacaag
attgctcaaggcgtcgagcctgagaagaacaaggcgctgttggcggacctctgcaacacg
atgaagttcggctcgctctgtgcattaggcggctttacgccctatccggtgatgagcgcg
atgaatcacttcccggaggatttcgctccaacaccctttatcgaagcggcggagtaa

DBGET integrated database retrieval system