KEGG   Novosphingobium pentaromativorans: JI59_23035
Entry
JI59_23035        CDS       T03399                                 
Name
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:npn00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    JI59_23035
Enzymes [BR:npn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     JI59_23035
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-ProteinID: AIT82376
UniProt: G6EJI8
LinkDB
Position
pLA4:complement(60248..60781)
AA seq 177 aa
MKYGIAALTILGLATATAAIAQTSAPKAVKSDIVQAGGGKIGEVTLTNGRSGVLLRLTAS
GLTPGWHAMHFHATGDCSDQGFQKSGAHINHEDHKTPHGLLNPEGPDFGELPNIHVAADG
TVNAEAFSALVSLDAASSRPNLLDADGSALVIHASPDDHVTQPIGGAGARVACAVIR
NT seq 534 nt   +upstreamnt  +downstreamnt
atgaaatatgggatagcggctttgacgatcctgggactcgcaacggcaaccgcggcgatt
gcgcaaacttccgcgccgaaagccgtcaagagcgacatcgttcaggccggcggcggcaag
atcggagaggtgaccttgaccaacggtcgcagtggcgtgcttctgcgtctgacggcgtcc
gggctgacgcctggctggcacgccatgcatttccatgcgactggcgattgctccgaccaa
ggcttccagaaatcgggcgcgcatatcaaccacgaggatcacaagacacctcacgggctt
ctcaatccggaagggccggactttggggaattgccgaatattcatgtggcggcggacggc
accgtcaatgccgaagccttctcggcacttgtctcgctggacgcagcgtcatcccggccg
aaccttctcgatgccgatgggtccgccctggttattcacgccagccccgatgaccatgtc
acgcaaccgatcggcggggcgggcgcacgcgttgcgtgtgccgttatccggtaa

DBGET integrated database retrieval system