Nyctereutes procyonoides (raccoon dog): 129493568 Help Entry 129493568         CDS       T09008                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04022   cGMP-PKG signaling pathway npo04081   Hormone signaling npo04270   Vascular smooth muscle contraction npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     129493568 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     129493568 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     129493568 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     129493568 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129493568 (NPPC) Cytokines and neuropeptides [BR:npo04052]  Neuropeptides   Unclassified    129493568 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  129493568 NCBI-ProteinID:  XP_055155841 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKPRAAWVRLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcgcagctgctggcctgcgccctgctgctcacgctactctcgctccggcct tccgaagccaagcccggggcgccgccgaaggtcccgcgaactccgcccggggaggagctg gccgagccccaggctgcggggggcggtcagaagaagggcgacaaaactcccgggggcggc ggcgccaacctcaagggcgaccggtcgcgactgctccgggacctgcgcgtggacaccaag ccgcgggccgcgtgggtgcgcctcctgcatgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system