Nyctereutes procyonoides (raccoon dog): 129494491 Help Entry 129494491         CDS       T09008                                  Name (RefSeq) interferon alpha-1/2   KO K05414   interferon alpha Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04060   Cytokine-cytokine receptor interaction npo04151   PI3K-Akt signaling pathway npo04217   Necroptosis npo04620   Toll-like receptor signaling pathway npo04621   NOD-like receptor signaling pathway npo04622   RIG-I-like receptor signaling pathway npo04623   Cytosolic DNA-sensing pathway npo04630   JAK-STAT signaling pathway npo04650   Natural killer cell mediated cytotoxicity npo04936   Alcoholic liver disease npo05152   Tuberculosis npo05160   Hepatitis C npo05161   Hepatitis B npo05162   Measles npo05163   Human cytomegalovirus infection npo05164   Influenza A npo05165   Human papillomavirus infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05168   Herpes simplex virus 1 infection npo05169   Epstein-Barr virus infection npo05170   Human immunodeficiency virus 1 infection npo05171   Coronavirus disease - COVID-19 npo05200   Pathways in cancer npo05320   Autoimmune thyroid disease npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129494491    04151 PI3K-Akt signaling pathway     129494491   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129494491  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129494491  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129494491    04621 NOD-like receptor signaling pathway     129494491    04622 RIG-I-like receptor signaling pathway     129494491    04623 Cytosolic DNA-sensing pathway     129494491    04650 Natural killer cell mediated cytotoxicity     129494491  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129494491   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129494491    05161 Hepatitis B     129494491    05160 Hepatitis C     129494491    05171 Coronavirus disease - COVID-19     129494491    05164 Influenza A     129494491    05162 Measles     129494491    05168 Herpes simplex virus 1 infection     129494491    05163 Human cytomegalovirus infection     129494491    05167 Kaposi sarcoma-associated herpesvirus infection     129494491    05169 Epstein-Barr virus infection     129494491    05165 Human papillomavirus infection     129494491   09171 Infectious disease: bacterial    05152 Tuberculosis     129494491   09163 Immune disease    05320 Autoimmune thyroid disease     129494491   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129494491   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129494491  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129494491 Cytokines and neuropeptides [BR:npo04052]  Cytokines   Interferons    129494491 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  129494491 NCBI-ProteinID:  XP_055157351 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MAVPCSFSVALVLLSCHSLCSLACDLPDTHGLRNWRVLTLLGQMRRLSAGSCDHYTNDFA FPKELFDGQRLQEAQALSVVHVMTQKVFHLFCTDTSSAPWNMTLLEELCSGLSEQLDDLE ACPLQEVGLAETPLTHDDSTLRTYFQRISLYLQDKNHSPCAWEMVRAEIGRSFFSSTILQ ERIRRRK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccgtgccctgctccttctcggtggccctggtgctgctcagctgccactccctgtgc agtctggcttgcgacctgcccgacacccacggcctgcgcaactggagggtcctgacgctc ctgggacagatgaggagactctccgccggctcttgtgaccactacaccaatgactttgcc ttccccaaggagctgtttgatggccagcggctccaggaggcgcaggccctctctgtggtc cacgtgatgacccagaaggtcttccacctcttctgcacggacacgtcctctgctccttgg aacatgactctcctggaggaactgtgctcggggctctcggagcagctggatgacctggag gcctgtcccctgcaggaagtggggctggccgagacccccctcacgcatgacgactccacc ctgaggacctacttccagaggatctccctctacctgcaagacaagaaccacagcccgtgt gcctgggagatggtccgagcagaaatcgggagatccttcttctcctcgacaatcttgcaa gaaagaatcaggaggaggaaatga

DBGET integrated database retrieval system