Nyctereutes procyonoides (raccoon dog): 129495049 Help Entry 129495049         CDS       T09008                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04010   MAPK signaling pathway npo04020   Calcium signaling pathway npo04022   cGMP-PKG signaling pathway npo04114   Oocyte meiosis npo04218   Cellular senescence npo04310   Wnt signaling pathway npo04360   Axon guidance npo04370   VEGF signaling pathway npo04380   Osteoclast differentiation npo04625   C-type lectin receptor signaling pathway npo04650   Natural killer cell mediated cytotoxicity npo04658   Th1 and Th2 cell differentiation npo04659   Th17 cell differentiation npo04660   T cell receptor signaling pathway npo04662   B cell receptor signaling pathway npo04720   Long-term potentiation npo04724   Glutamatergic synapse npo04921   Oxytocin signaling pathway npo04922   Glucagon signaling pathway npo04924   Renin secretion npo05010   Alzheimer disease npo05014   Amyotrophic lateral sclerosis npo05020   Prion disease npo05022   Pathways of neurodegeneration - multiple diseases npo05031   Amphetamine addiction npo05152   Tuberculosis npo05163   Human cytomegalovirus infection npo05166   Human T-cell leukemia virus 1 infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05170   Human immunodeficiency virus 1 infection npo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129495049 (PPP3R2)    04310 Wnt signaling pathway     129495049 (PPP3R2)    04370 VEGF signaling pathway     129495049 (PPP3R2)    04020 Calcium signaling pathway     129495049 (PPP3R2)    04022 cGMP-PKG signaling pathway     129495049 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129495049 (PPP3R2)    04218 Cellular senescence     129495049 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129495049 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     129495049 (PPP3R2)    04660 T cell receptor signaling pathway     129495049 (PPP3R2)    04658 Th1 and Th2 cell differentiation     129495049 (PPP3R2)    04659 Th17 cell differentiation     129495049 (PPP3R2)    04662 B cell receptor signaling pathway     129495049 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     129495049 (PPP3R2)    04921 Oxytocin signaling pathway     129495049 (PPP3R2)    04924 Renin secretion     129495049 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     129495049 (PPP3R2)    04720 Long-term potentiation     129495049 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     129495049 (PPP3R2)    04380 Osteoclast differentiation     129495049 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129495049 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129495049 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     129495049 (PPP3R2)    05163 Human cytomegalovirus infection     129495049 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     129495049 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     129495049 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     129495049 (PPP3R2)    05014 Amyotrophic lateral sclerosis     129495049 (PPP3R2)    05020 Prion disease     129495049 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     129495049 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     129495049 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129495049 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:npo01009]     129495049 (PPP3R2) Protein phosphatases and associated proteins [BR:npo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129495049 (PPP3R2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 SPARC_Ca_bdg EH EF-hand_9 USP32_N Motif Other DBs NCBI-GeneID:  129495049 NCBI-ProteinID:  XP_055158333 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEMCSHFSQDEIKRLGKRFKKLDLDCSGALSVDEFLSLPELQQNPLVQRVVD VFDTDGDGEVDFREFILGASQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GDNLKDWQLQQLVDKTIIILDRDGDGKISFEEFSAVVGGLEVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggggaacgaagccagttaccccgaggagatgtgctcccacttcagccaggacgaaatt aagaggctgggcaagcggttcaagaagctggacctggactgctcgggcgccctgagcgtg gacgagttcctgtcgctgcccgagctgcagcagaacccgctggtgcagcgagtggtcgac gtcttcgacacggacggcgacggagaggtggacttcagggagttcatcctgggggcctcc cagttcagcgtcaggggggacgaggagcagaagctgaggtttgccttcagcatctacgac atggataaggacggctacatctccaacggggagctcttccaggtgctgaagatgatggtc ggggacaacctgaaagactggcagttacagcagctggtggacaagaccatcatcatcctg gatagagacggggacgggaagatctccttcgaggagttcagtgctgtggtcggaggcctg gaggtgcacaagaagctggtggtaattgtgtga

DBGET integrated database retrieval system