Nyctereutes procyonoides (raccoon dog): 129496481 Help Entry 129496481         CDS       T09008                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo01521   EGFR tyrosine kinase inhibitor resistance npo01524   Platinum drug resistance npo04014   Ras signaling pathway npo04064   NF-kappa B signaling pathway npo04115   p53 signaling pathway npo04137   Mitophagy - animal npo04140   Autophagy - animal npo04151   PI3K-Akt signaling pathway npo04210   Apoptosis npo04215   Apoptosis - multiple species npo04621   NOD-like receptor signaling pathway npo04630   JAK-STAT signaling pathway npo05012   Parkinson disease npo05014   Amyotrophic lateral sclerosis npo05022   Pathways of neurodegeneration - multiple diseases npo05145   Toxoplasmosis npo05162   Measles npo05166   Human T-cell leukemia virus 1 infection npo05168   Herpes simplex virus 1 infection npo05170   Human immunodeficiency virus 1 infection npo05200   Pathways in cancer npo05202   Transcriptional misregulation in cancer npo05212   Pancreatic cancer npo05220   Chronic myeloid leukemia npo05222   Small cell lung cancer npo05225   Hepatocellular carcinoma npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129496481 (BCL2L1)    04630 JAK-STAT signaling pathway     129496481 (BCL2L1)    04064 NF-kappa B signaling pathway     129496481 (BCL2L1)    04151 PI3K-Akt signaling pathway     129496481 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129496481 (BCL2L1)    04137 Mitophagy - animal     129496481 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     129496481 (BCL2L1)    04215 Apoptosis - multiple species     129496481 (BCL2L1)    04115 p53 signaling pathway     129496481 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129496481 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129496481 (BCL2L1)    05202 Transcriptional misregulation in cancer     129496481 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     129496481 (BCL2L1)    05225 Hepatocellular carcinoma     129496481 (BCL2L1)    05220 Chronic myeloid leukemia     129496481 (BCL2L1)    05222 Small cell lung cancer     129496481 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129496481 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     129496481 (BCL2L1)    05162 Measles     129496481 (BCL2L1)    05168 Herpes simplex virus 1 infection     129496481 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     129496481 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     129496481 (BCL2L1)    05014 Amyotrophic lateral sclerosis     129496481 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     129496481 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129496481 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     129496481 (BCL2L1)    01524 Platinum drug resistance     129496481 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:npo01009]     129496481 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npo03036]     129496481 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:npo02000]     129496481 (BCL2L1) Protein phosphatases and associated proteins [BR:npo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      129496481 (BCL2L1) Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     129496481 (BCL2L1) Transporters [BR:npo02000]  Other transporters   Pores ion channels [TC:1]    129496481 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  129496481 NCBI-ProteinID:  XP_055160568 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaaacaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system