Nyctereutes procyonoides (raccoon dog): 129497811 Help Entry 129497811         CDS       T09008                                  Symbol JUN Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo01522   Endocrine resistance npo04010   MAPK signaling pathway npo04012   ErbB signaling pathway npo04024   cAMP signaling pathway npo04137   Mitophagy - animal npo04210   Apoptosis npo04310   Wnt signaling pathway npo04380   Osteoclast differentiation npo04510   Focal adhesion npo04530   Tight junction npo04620   Toll-like receptor signaling pathway npo04621   NOD-like receptor signaling pathway npo04625   C-type lectin receptor signaling pathway npo04657   IL-17 signaling pathway npo04658   Th1 and Th2 cell differentiation npo04659   Th17 cell differentiation npo04660   T cell receptor signaling pathway npo04662   B cell receptor signaling pathway npo04668   TNF signaling pathway npo04722   Neurotrophin signaling pathway npo04912   GnRH signaling pathway npo04915   Estrogen signaling pathway npo04921   Oxytocin signaling pathway npo04926   Relaxin signaling pathway npo04932   Non-alcoholic fatty liver disease npo04933   AGE-RAGE signaling pathway in diabetic complications npo05030   Cocaine addiction npo05031   Amphetamine addiction npo05132   Salmonella infection npo05133   Pertussis npo05135   Yersinia infection npo05140   Leishmaniasis npo05142   Chagas disease npo05161   Hepatitis B npo05162   Measles npo05166   Human T-cell leukemia virus 1 infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05169   Epstein-Barr virus infection npo05170   Human immunodeficiency virus 1 infection npo05171   Coronavirus disease - COVID-19 npo05200   Pathways in cancer npo05203   Viral carcinogenesis npo05207   Chemical carcinogenesis - receptor activation npo05208   Chemical carcinogenesis - reactive oxygen species npo05210   Colorectal cancer npo05211   Renal cell carcinoma npo05224   Breast cancer npo05231   Choline metabolism in cancer npo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer npo05321   Inflammatory bowel disease npo05323   Rheumatoid arthritis npo05417   Lipid and atherosclerosis npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129497811 (JUN)    04012 ErbB signaling pathway     129497811 (JUN)    04310 Wnt signaling pathway     129497811 (JUN)    04668 TNF signaling pathway     129497811 (JUN)    04024 cAMP signaling pathway     129497811 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     129497811 (JUN)   09143 Cell growth and death    04210 Apoptosis     129497811 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     129497811 (JUN)    04530 Tight junction     129497811 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129497811 (JUN)    04621 NOD-like receptor signaling pathway     129497811 (JUN)    04625 C-type lectin receptor signaling pathway     129497811 (JUN)    04660 T cell receptor signaling pathway     129497811 (JUN)    04658 Th1 and Th2 cell differentiation     129497811 (JUN)    04659 Th17 cell differentiation     129497811 (JUN)    04657 IL-17 signaling pathway     129497811 (JUN)    04662 B cell receptor signaling pathway     129497811 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     129497811 (JUN)    04915 Estrogen signaling pathway     129497811 (JUN)    04921 Oxytocin signaling pathway     129497811 (JUN)    04926 Relaxin signaling pathway     129497811 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     129497811 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     129497811 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129497811 (JUN)    05207 Chemical carcinogenesis - receptor activation     129497811 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     129497811 (JUN)    05203 Viral carcinogenesis     129497811 (JUN)    05231 Choline metabolism in cancer     129497811 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129497811 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     129497811 (JUN)    05211 Renal cell carcinoma     129497811 (JUN)    05224 Breast cancer     129497811 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129497811 (JUN)    05170 Human immunodeficiency virus 1 infection     129497811 (JUN)    05161 Hepatitis B     129497811 (JUN)    05171 Coronavirus disease - COVID-19     129497811 (JUN)    05162 Measles     129497811 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     129497811 (JUN)    05169 Epstein-Barr virus infection     129497811 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     129497811 (JUN)    05135 Yersinia infection     129497811 (JUN)    05133 Pertussis     129497811 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     129497811 (JUN)    05142 Chagas disease     129497811 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     129497811 (JUN)    05321 Inflammatory bowel disease     129497811 (JUN)   09165 Substance dependence    05030 Cocaine addiction     129497811 (JUN)    05031 Amphetamine addiction     129497811 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129497811 (JUN)    05418 Fluid shear stress and atherosclerosis     129497811 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     129497811 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     129497811 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     129497811 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:npo03000]     129497811 (JUN) Transcription factors [BR:npo03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     129497811 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_Maf bZIP_2 MIC19_MIC25 Rab11-FIP3 RIMB1_N ZapB PspA_IM30 CCDC192 Fib_alpha T4SS_LegC2C7 DUF3450 FlaC_arch Map3k7cl Motif Other DBs NCBI-GeneID:  129497811 NCBI-ProteinID:  XP_055162941 LinkDB All DBs Position Unknown AA seq 348 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASAAGGGGGGGGGFGAGLHSEPPVYANLSNFNP GALSGGGGAPSYGAAGLAFPAQPQQPPPPPPPPQQQQPQQPPPAPHHLSQQIPVQHPRLQ ALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEK VKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg aacctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactcggacctg ctcacctcgccggacgtggggctgctcaagctggcctcgcccgagctggagcgcctgatc atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcctgtgcccc aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggcgcg ggcttggtggccccggcggtggcctcggcggcgggcggcggcggcggcggcggcggcggc ttcggcgcgggcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccg ggcgcgctgagcggcggcggcggggcgccctcctacggcgcggccggcctggcctttccc gcgcagccccagcagccgccgccgccgccgccgccgccgcagcagcagcagccgcagcag cccccgccagcgccgcaccacctgtcccagcagatccccgtgcagcacccgcgcctgcag gccctgaaggaggagccgcagacggtgcccgagatgcccggggagacgccgcccctgtcc cccatcgacatggagtcgcaagagaggatcaaggccgagaggaagcgcatgaggaaccgc atagctgcctccaagtgccggaaaaggaagctggagaggatcgcccggctggaggaaaaa gtgaaaaccttgaaagcgcagaactcggagctggcgtccacggccaacatgctcagggaa caggtggcacagcttaaacagaaagtcatgaatcacgttaacagtgggtgccagctcatg ctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system