Nyctereutes procyonoides (raccoon dog): 129498851 Help Entry 129498851         CDS       T09008                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04024   cAMP signaling pathway npo04080   Neuroactive ligand-receptor interaction npo04081   Hormone signaling npo04935   Growth hormone synthesis, secretion and action npo04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     129498851 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     129498851 (SST)    04081 Hormone signaling     129498851 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     129498851 (SST)   09154 Digestive system    04971 Gastric acid secretion     129498851 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129498851 (SST) Cytokines and neuropeptides [BR:npo04052]  Neuropeptides   GPCR binding    129498851 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  129498851 NCBI-ProteinID:  XP_055164401 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTCAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggccctgggc ggtgtcacctgcgcgccctcggacccccgactccgccagtttctgcagaagtccctggct gccgccgcggggaagcaggaactggccaagtacttcttggcagagctgctgtctgaaccc aaccagacagagaatgatgccctggaacctgaagacttgtcccaggctgctgagcaggat gaaatgaggctggaactgcagagatctgctaactcaaaccccgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacatcctgttag

DBGET integrated database retrieval system