KEGG   Nyctereutes procyonoides (raccoon dog): 129501466
Entry
129501466         CDS       T09008                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
npo  Nyctereutes procyonoides (raccoon dog)
Pathway
npo01521  EGFR tyrosine kinase inhibitor resistance
npo01522  Endocrine resistance
npo04010  MAPK signaling pathway
npo04012  ErbB signaling pathway
npo04014  Ras signaling pathway
npo04015  Rap1 signaling pathway
npo04062  Chemokine signaling pathway
npo04068  FoxO signaling pathway
npo04071  Sphingolipid signaling pathway
npo04072  Phospholipase D signaling pathway
npo04137  Mitophagy - animal
npo04140  Autophagy - animal
npo04150  mTOR signaling pathway
npo04151  PI3K-Akt signaling pathway
npo04210  Apoptosis
npo04211  Longevity regulating pathway
npo04213  Longevity regulating pathway - multiple species
npo04218  Cellular senescence
npo04360  Axon guidance
npo04370  VEGF signaling pathway
npo04371  Apelin signaling pathway
npo04540  Gap junction
npo04550  Signaling pathways regulating pluripotency of stem cells
npo04625  C-type lectin receptor signaling pathway
npo04650  Natural killer cell mediated cytotoxicity
npo04660  T cell receptor signaling pathway
npo04662  B cell receptor signaling pathway
npo04664  Fc epsilon RI signaling pathway
npo04714  Thermogenesis
npo04720  Long-term potentiation
npo04722  Neurotrophin signaling pathway
npo04725  Cholinergic synapse
npo04726  Serotonergic synapse
npo04730  Long-term depression
npo04810  Regulation of actin cytoskeleton
npo04910  Insulin signaling pathway
npo04912  GnRH signaling pathway
npo04915  Estrogen signaling pathway
npo04916  Melanogenesis
npo04917  Prolactin signaling pathway
npo04919  Thyroid hormone signaling pathway
npo04921  Oxytocin signaling pathway
npo04926  Relaxin signaling pathway
npo04929  GnRH secretion
npo04933  AGE-RAGE signaling pathway in diabetic complications
npo04935  Growth hormone synthesis, secretion and action
npo05010  Alzheimer disease
npo05022  Pathways of neurodegeneration - multiple diseases
npo05034  Alcoholism
npo05160  Hepatitis C
npo05161  Hepatitis B
npo05163  Human cytomegalovirus infection
npo05165  Human papillomavirus infection
npo05166  Human T-cell leukemia virus 1 infection
npo05167  Kaposi sarcoma-associated herpesvirus infection
npo05170  Human immunodeficiency virus 1 infection
npo05200  Pathways in cancer
npo05203  Viral carcinogenesis
npo05205  Proteoglycans in cancer
npo05206  MicroRNAs in cancer
npo05207  Chemical carcinogenesis - receptor activation
npo05208  Chemical carcinogenesis - reactive oxygen species
npo05210  Colorectal cancer
npo05211  Renal cell carcinoma
npo05213  Endometrial cancer
npo05214  Glioma
npo05215  Prostate cancer
npo05216  Thyroid cancer
npo05218  Melanoma
npo05219  Bladder cancer
npo05220  Chronic myeloid leukemia
npo05221  Acute myeloid leukemia
npo05223  Non-small cell lung cancer
npo05224  Breast cancer
npo05225  Hepatocellular carcinoma
npo05226  Gastric cancer
npo05230  Central carbon metabolism in cancer
npo05231  Choline metabolism in cancer
npo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
npo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:npo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129501466 (NRAS)
   04012 ErbB signaling pathway
    129501466 (NRAS)
   04014 Ras signaling pathway
    129501466 (NRAS)
   04015 Rap1 signaling pathway
    129501466 (NRAS)
   04370 VEGF signaling pathway
    129501466 (NRAS)
   04371 Apelin signaling pathway
    129501466 (NRAS)
   04068 FoxO signaling pathway
    129501466 (NRAS)
   04072 Phospholipase D signaling pathway
    129501466 (NRAS)
   04071 Sphingolipid signaling pathway
    129501466 (NRAS)
   04151 PI3K-Akt signaling pathway
    129501466 (NRAS)
   04150 mTOR signaling pathway
    129501466 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    129501466 (NRAS)
   04137 Mitophagy - animal
    129501466 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    129501466 (NRAS)
   04218 Cellular senescence
    129501466 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    129501466 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    129501466 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129501466 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    129501466 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    129501466 (NRAS)
   04660 T cell receptor signaling pathway
    129501466 (NRAS)
   04662 B cell receptor signaling pathway
    129501466 (NRAS)
   04664 Fc epsilon RI signaling pathway
    129501466 (NRAS)
   04062 Chemokine signaling pathway
    129501466 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    129501466 (NRAS)
   04929 GnRH secretion
    129501466 (NRAS)
   04912 GnRH signaling pathway
    129501466 (NRAS)
   04915 Estrogen signaling pathway
    129501466 (NRAS)
   04917 Prolactin signaling pathway
    129501466 (NRAS)
   04921 Oxytocin signaling pathway
    129501466 (NRAS)
   04926 Relaxin signaling pathway
    129501466 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    129501466 (NRAS)
   04919 Thyroid hormone signaling pathway
    129501466 (NRAS)
   04916 Melanogenesis
    129501466 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    129501466 (NRAS)
   04726 Serotonergic synapse
    129501466 (NRAS)
   04720 Long-term potentiation
    129501466 (NRAS)
   04730 Long-term depression
    129501466 (NRAS)
   04722 Neurotrophin signaling pathway
    129501466 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    129501466 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    129501466 (NRAS)
   04213 Longevity regulating pathway - multiple species
    129501466 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    129501466 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129501466 (NRAS)
   05206 MicroRNAs in cancer
    129501466 (NRAS)
   05205 Proteoglycans in cancer
    129501466 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    129501466 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    129501466 (NRAS)
   05203 Viral carcinogenesis
    129501466 (NRAS)
   05230 Central carbon metabolism in cancer
    129501466 (NRAS)
   05231 Choline metabolism in cancer
    129501466 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129501466 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    129501466 (NRAS)
   05225 Hepatocellular carcinoma
    129501466 (NRAS)
   05226 Gastric cancer
    129501466 (NRAS)
   05214 Glioma
    129501466 (NRAS)
   05216 Thyroid cancer
    129501466 (NRAS)
   05221 Acute myeloid leukemia
    129501466 (NRAS)
   05220 Chronic myeloid leukemia
    129501466 (NRAS)
   05218 Melanoma
    129501466 (NRAS)
   05211 Renal cell carcinoma
    129501466 (NRAS)
   05219 Bladder cancer
    129501466 (NRAS)
   05215 Prostate cancer
    129501466 (NRAS)
   05213 Endometrial cancer
    129501466 (NRAS)
   05224 Breast cancer
    129501466 (NRAS)
   05223 Non-small cell lung cancer
    129501466 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129501466 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    129501466 (NRAS)
   05161 Hepatitis B
    129501466 (NRAS)
   05160 Hepatitis C
    129501466 (NRAS)
   05163 Human cytomegalovirus infection
    129501466 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    129501466 (NRAS)
   05165 Human papillomavirus infection
    129501466 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129501466 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    129501466 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    129501466 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129501466 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    129501466 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129501466 (NRAS)
   01522 Endocrine resistance
    129501466 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:npo04131]
    129501466 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npo04147]
    129501466 (NRAS)
   04031 GTP-binding proteins [BR:npo04031]
    129501466 (NRAS)
Membrane trafficking [BR:npo04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    129501466 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    129501466 (NRAS)
Exosome [BR:npo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129501466 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   129501466 (NRAS)
  Exosomal proteins of breast cancer cells
   129501466 (NRAS)
  Exosomal proteins of colorectal cancer cells
   129501466 (NRAS)
GTP-binding proteins [BR:npo04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    129501466 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 129501466
NCBI-ProteinID: XP_055168599
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagacggtgaaacctgtctgttggatatactggatacagctggt
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaaatcatttgcagacattaacctctacagggaacagatt
aagcgagttaaagattcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaggatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system