Nyctereutes procyonoides (raccoon dog): 129501466 Help Entry 129501466         CDS       T09008                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo01521   EGFR tyrosine kinase inhibitor resistance npo01522   Endocrine resistance npo04010   MAPK signaling pathway npo04012   ErbB signaling pathway npo04014   Ras signaling pathway npo04015   Rap1 signaling pathway npo04062   Chemokine signaling pathway npo04068   FoxO signaling pathway npo04071   Sphingolipid signaling pathway npo04072   Phospholipase D signaling pathway npo04137   Mitophagy - animal npo04140   Autophagy - animal npo04150   mTOR signaling pathway npo04151   PI3K-Akt signaling pathway npo04210   Apoptosis npo04211   Longevity regulating pathway npo04213   Longevity regulating pathway - multiple species npo04218   Cellular senescence npo04360   Axon guidance npo04370   VEGF signaling pathway npo04371   Apelin signaling pathway npo04540   Gap junction npo04550   Signaling pathways regulating pluripotency of stem cells npo04625   C-type lectin receptor signaling pathway npo04650   Natural killer cell mediated cytotoxicity npo04660   T cell receptor signaling pathway npo04662   B cell receptor signaling pathway npo04664   Fc epsilon RI signaling pathway npo04714   Thermogenesis npo04720   Long-term potentiation npo04722   Neurotrophin signaling pathway npo04725   Cholinergic synapse npo04726   Serotonergic synapse npo04730   Long-term depression npo04810   Regulation of actin cytoskeleton npo04910   Insulin signaling pathway npo04912   GnRH signaling pathway npo04915   Estrogen signaling pathway npo04916   Melanogenesis npo04917   Prolactin signaling pathway npo04919   Thyroid hormone signaling pathway npo04921   Oxytocin signaling pathway npo04926   Relaxin signaling pathway npo04929   GnRH secretion npo04933   AGE-RAGE signaling pathway in diabetic complications npo04935   Growth hormone synthesis, secretion and action npo05010   Alzheimer disease npo05022   Pathways of neurodegeneration - multiple diseases npo05034   Alcoholism npo05160   Hepatitis C npo05161   Hepatitis B npo05163   Human cytomegalovirus infection npo05165   Human papillomavirus infection npo05166   Human T-cell leukemia virus 1 infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05170   Human immunodeficiency virus 1 infection npo05200   Pathways in cancer npo05203   Viral carcinogenesis npo05205   Proteoglycans in cancer npo05206   MicroRNAs in cancer npo05207   Chemical carcinogenesis - receptor activation npo05208   Chemical carcinogenesis - reactive oxygen species npo05210   Colorectal cancer npo05211   Renal cell carcinoma npo05213   Endometrial cancer npo05214   Glioma npo05215   Prostate cancer npo05216   Thyroid cancer npo05218   Melanoma npo05219   Bladder cancer npo05220   Chronic myeloid leukemia npo05221   Acute myeloid leukemia npo05223   Non-small cell lung cancer npo05224   Breast cancer npo05225   Hepatocellular carcinoma npo05226   Gastric cancer npo05230   Central carbon metabolism in cancer npo05231   Choline metabolism in cancer npo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129501466 (NRAS)    04012 ErbB signaling pathway     129501466 (NRAS)    04014 Ras signaling pathway     129501466 (NRAS)    04015 Rap1 signaling pathway     129501466 (NRAS)    04370 VEGF signaling pathway     129501466 (NRAS)    04371 Apelin signaling pathway     129501466 (NRAS)    04068 FoxO signaling pathway     129501466 (NRAS)    04072 Phospholipase D signaling pathway     129501466 (NRAS)    04071 Sphingolipid signaling pathway     129501466 (NRAS)    04151 PI3K-Akt signaling pathway     129501466 (NRAS)    04150 mTOR signaling pathway     129501466 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129501466 (NRAS)    04137 Mitophagy - animal     129501466 (NRAS)   09143 Cell growth and death    04210 Apoptosis     129501466 (NRAS)    04218 Cellular senescence     129501466 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     129501466 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     129501466 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129501466 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129501466 (NRAS)    04650 Natural killer cell mediated cytotoxicity     129501466 (NRAS)    04660 T cell receptor signaling pathway     129501466 (NRAS)    04662 B cell receptor signaling pathway     129501466 (NRAS)    04664 Fc epsilon RI signaling pathway     129501466 (NRAS)    04062 Chemokine signaling pathway     129501466 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     129501466 (NRAS)    04929 GnRH secretion     129501466 (NRAS)    04912 GnRH signaling pathway     129501466 (NRAS)    04915 Estrogen signaling pathway     129501466 (NRAS)    04917 Prolactin signaling pathway     129501466 (NRAS)    04921 Oxytocin signaling pathway     129501466 (NRAS)    04926 Relaxin signaling pathway     129501466 (NRAS)    04935 Growth hormone synthesis, secretion and action     129501466 (NRAS)    04919 Thyroid hormone signaling pathway     129501466 (NRAS)    04916 Melanogenesis     129501466 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     129501466 (NRAS)    04726 Serotonergic synapse     129501466 (NRAS)    04720 Long-term potentiation     129501466 (NRAS)    04730 Long-term depression     129501466 (NRAS)    04722 Neurotrophin signaling pathway     129501466 (NRAS)   09158 Development and regeneration    04360 Axon guidance     129501466 (NRAS)   09149 Aging    04211 Longevity regulating pathway     129501466 (NRAS)    04213 Longevity regulating pathway - multiple species     129501466 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     129501466 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129501466 (NRAS)    05206 MicroRNAs in cancer     129501466 (NRAS)    05205 Proteoglycans in cancer     129501466 (NRAS)    05207 Chemical carcinogenesis - receptor activation     129501466 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     129501466 (NRAS)    05203 Viral carcinogenesis     129501466 (NRAS)    05230 Central carbon metabolism in cancer     129501466 (NRAS)    05231 Choline metabolism in cancer     129501466 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129501466 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     129501466 (NRAS)    05225 Hepatocellular carcinoma     129501466 (NRAS)    05226 Gastric cancer     129501466 (NRAS)    05214 Glioma     129501466 (NRAS)    05216 Thyroid cancer     129501466 (NRAS)    05221 Acute myeloid leukemia     129501466 (NRAS)    05220 Chronic myeloid leukemia     129501466 (NRAS)    05218 Melanoma     129501466 (NRAS)    05211 Renal cell carcinoma     129501466 (NRAS)    05219 Bladder cancer     129501466 (NRAS)    05215 Prostate cancer     129501466 (NRAS)    05213 Endometrial cancer     129501466 (NRAS)    05224 Breast cancer     129501466 (NRAS)    05223 Non-small cell lung cancer     129501466 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129501466 (NRAS)    05170 Human immunodeficiency virus 1 infection     129501466 (NRAS)    05161 Hepatitis B     129501466 (NRAS)    05160 Hepatitis C     129501466 (NRAS)    05163 Human cytomegalovirus infection     129501466 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     129501466 (NRAS)    05165 Human papillomavirus infection     129501466 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     129501466 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     129501466 (NRAS)   09165 Substance dependence    05034 Alcoholism     129501466 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129501466 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     129501466 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     129501466 (NRAS)    01522 Endocrine resistance     129501466 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129501466 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129501466 (NRAS)    04031 GTP-binding proteins [BR:npo04031]     129501466 (NRAS) Membrane trafficking [BR:npo04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129501466 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     129501466 (NRAS) Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129501466 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    129501466 (NRAS)   Exosomal proteins of breast cancer cells    129501466 (NRAS)   Exosomal proteins of colorectal cancer cells    129501466 (NRAS) GTP-binding proteins [BR:npo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129501466 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  129501466 NCBI-ProteinID:  XP_055168599 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagacggtgaaacctgtctgttggatatactggatacagctggt caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt gtatttgccatcaataatagcaaatcatttgcagacattaacctctacagggaacagatt aagcgagttaaagattcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaggatgccttttacacactggta agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system