Nyctereutes procyonoides (raccoon dog): 129501491 Help Entry 129501491         CDS       T09008                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04613   Neutrophil extracellular trap formation npo05034   Alcoholism npo05202   Transcriptional misregulation in cancer npo05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:npo00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129501491  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129501491   09163 Immune disease    05322 Systemic lupus erythematosus     129501491   09165 Substance dependence    05034 Alcoholism     129501491  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npo03036]     129501491   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129501491 Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129501491 Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129501491 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  129501491 NCBI-ProteinID:  XP_055168632 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacgaaacagaccgcccgcaagtcgaccggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgcccgccacgggcggcgtcaagaagccgcac cgctaccggccgggcacggtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggatctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcttga

DBGET integrated database retrieval system