Nyctereutes procyonoides (raccoon dog): 129501502 Help Entry 129501502         CDS       T09008                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04382   Cornified envelope formation npo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npo00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     129501502 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129501502 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129501502 (S100A10) Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of microglial cells    129501502 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  129501502 NCBI-ProteinID:  XP_055168642 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggatacttgacaaaggaagacctgagagtactcatggaaaaggaattccca ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctcgac cagtgccgagatggcaaagtgggcttccagagcttcttttcactaattgctgggctcacc attgcatgcaatgactattttgtaatacacatgaagcagaagggcaagaaatag

DBGET integrated database retrieval system