KEGG   Nyctereutes procyonoides (raccoon dog): 129502349
Entry
129502349         CDS       T09008                                 
Name
(RefSeq) mitogen-activated protein kinase 3-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
npo  Nyctereutes procyonoides (raccoon dog)
Pathway
npo01521  EGFR tyrosine kinase inhibitor resistance
npo01522  Endocrine resistance
npo01524  Platinum drug resistance
npo04010  MAPK signaling pathway
npo04012  ErbB signaling pathway
npo04014  Ras signaling pathway
npo04015  Rap1 signaling pathway
npo04022  cGMP-PKG signaling pathway
npo04024  cAMP signaling pathway
npo04062  Chemokine signaling pathway
npo04066  HIF-1 signaling pathway
npo04068  FoxO signaling pathway
npo04071  Sphingolipid signaling pathway
npo04072  Phospholipase D signaling pathway
npo04114  Oocyte meiosis
npo04140  Autophagy - animal
npo04148  Efferocytosis
npo04150  mTOR signaling pathway
npo04151  PI3K-Akt signaling pathway
npo04210  Apoptosis
npo04218  Cellular senescence
npo04261  Adrenergic signaling in cardiomyocytes
npo04270  Vascular smooth muscle contraction
npo04350  TGF-beta signaling pathway
npo04360  Axon guidance
npo04370  VEGF signaling pathway
npo04371  Apelin signaling pathway
npo04380  Osteoclast differentiation
npo04510  Focal adhesion
npo04520  Adherens junction
npo04540  Gap junction
npo04550  Signaling pathways regulating pluripotency of stem cells
npo04611  Platelet activation
npo04613  Neutrophil extracellular trap formation
npo04620  Toll-like receptor signaling pathway
npo04621  NOD-like receptor signaling pathway
npo04625  C-type lectin receptor signaling pathway
npo04650  Natural killer cell mediated cytotoxicity
npo04657  IL-17 signaling pathway
npo04658  Th1 and Th2 cell differentiation
npo04659  Th17 cell differentiation
npo04660  T cell receptor signaling pathway
npo04662  B cell receptor signaling pathway
npo04664  Fc epsilon RI signaling pathway
npo04666  Fc gamma R-mediated phagocytosis
npo04668  TNF signaling pathway
npo04713  Circadian entrainment
npo04720  Long-term potentiation
npo04722  Neurotrophin signaling pathway
npo04723  Retrograde endocannabinoid signaling
npo04724  Glutamatergic synapse
npo04725  Cholinergic synapse
npo04726  Serotonergic synapse
npo04730  Long-term depression
npo04810  Regulation of actin cytoskeleton
npo04910  Insulin signaling pathway
npo04912  GnRH signaling pathway
npo04914  Progesterone-mediated oocyte maturation
npo04915  Estrogen signaling pathway
npo04916  Melanogenesis
npo04917  Prolactin signaling pathway
npo04919  Thyroid hormone signaling pathway
npo04921  Oxytocin signaling pathway
npo04926  Relaxin signaling pathway
npo04928  Parathyroid hormone synthesis, secretion and action
npo04929  GnRH secretion
npo04930  Type II diabetes mellitus
npo04933  AGE-RAGE signaling pathway in diabetic complications
npo04934  Cushing syndrome
npo04935  Growth hormone synthesis, secretion and action
npo04960  Aldosterone-regulated sodium reabsorption
npo05010  Alzheimer disease
npo05020  Prion disease
npo05022  Pathways of neurodegeneration - multiple diseases
npo05034  Alcoholism
npo05132  Salmonella infection
npo05133  Pertussis
npo05135  Yersinia infection
npo05140  Leishmaniasis
npo05142  Chagas disease
npo05145  Toxoplasmosis
npo05152  Tuberculosis
npo05160  Hepatitis C
npo05161  Hepatitis B
npo05163  Human cytomegalovirus infection
npo05164  Influenza A
npo05165  Human papillomavirus infection
npo05166  Human T-cell leukemia virus 1 infection
npo05167  Kaposi sarcoma-associated herpesvirus infection
npo05170  Human immunodeficiency virus 1 infection
npo05171  Coronavirus disease - COVID-19
npo05200  Pathways in cancer
npo05203  Viral carcinogenesis
npo05205  Proteoglycans in cancer
npo05206  MicroRNAs in cancer
npo05207  Chemical carcinogenesis - receptor activation
npo05208  Chemical carcinogenesis - reactive oxygen species
npo05210  Colorectal cancer
npo05211  Renal cell carcinoma
npo05212  Pancreatic cancer
npo05213  Endometrial cancer
npo05214  Glioma
npo05215  Prostate cancer
npo05216  Thyroid cancer
npo05218  Melanoma
npo05219  Bladder cancer
npo05220  Chronic myeloid leukemia
npo05221  Acute myeloid leukemia
npo05223  Non-small cell lung cancer
npo05224  Breast cancer
npo05225  Hepatocellular carcinoma
npo05226  Gastric cancer
npo05230  Central carbon metabolism in cancer
npo05231  Choline metabolism in cancer
npo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
npo05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:npo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129502349
   04012 ErbB signaling pathway
    129502349
   04014 Ras signaling pathway
    129502349
   04015 Rap1 signaling pathway
    129502349
   04350 TGF-beta signaling pathway
    129502349
   04370 VEGF signaling pathway
    129502349
   04371 Apelin signaling pathway
    129502349
   04668 TNF signaling pathway
    129502349
   04066 HIF-1 signaling pathway
    129502349
   04068 FoxO signaling pathway
    129502349
   04072 Phospholipase D signaling pathway
    129502349
   04071 Sphingolipid signaling pathway
    129502349
   04024 cAMP signaling pathway
    129502349
   04022 cGMP-PKG signaling pathway
    129502349
   04151 PI3K-Akt signaling pathway
    129502349
   04150 mTOR signaling pathway
    129502349
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    129502349
   04148 Efferocytosis
    129502349
  09143 Cell growth and death
   04114 Oocyte meiosis
    129502349
   04210 Apoptosis
    129502349
   04218 Cellular senescence
    129502349
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    129502349
   04520 Adherens junction
    129502349
   04540 Gap junction
    129502349
   04550 Signaling pathways regulating pluripotency of stem cells
    129502349
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129502349
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    129502349
   04613 Neutrophil extracellular trap formation
    129502349
   04620 Toll-like receptor signaling pathway
    129502349
   04621 NOD-like receptor signaling pathway
    129502349
   04625 C-type lectin receptor signaling pathway
    129502349
   04650 Natural killer cell mediated cytotoxicity
    129502349
   04660 T cell receptor signaling pathway
    129502349
   04658 Th1 and Th2 cell differentiation
    129502349
   04659 Th17 cell differentiation
    129502349
   04657 IL-17 signaling pathway
    129502349
   04662 B cell receptor signaling pathway
    129502349
   04664 Fc epsilon RI signaling pathway
    129502349
   04666 Fc gamma R-mediated phagocytosis
    129502349
   04062 Chemokine signaling pathway
    129502349
  09152 Endocrine system
   04910 Insulin signaling pathway
    129502349
   04929 GnRH secretion
    129502349
   04912 GnRH signaling pathway
    129502349
   04915 Estrogen signaling pathway
    129502349
   04914 Progesterone-mediated oocyte maturation
    129502349
   04917 Prolactin signaling pathway
    129502349
   04921 Oxytocin signaling pathway
    129502349
   04926 Relaxin signaling pathway
    129502349
   04935 Growth hormone synthesis, secretion and action
    129502349
   04919 Thyroid hormone signaling pathway
    129502349
   04928 Parathyroid hormone synthesis, secretion and action
    129502349
   04916 Melanogenesis
    129502349
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    129502349
   04270 Vascular smooth muscle contraction
    129502349
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    129502349
  09156 Nervous system
   04724 Glutamatergic synapse
    129502349
   04725 Cholinergic synapse
    129502349
   04726 Serotonergic synapse
    129502349
   04720 Long-term potentiation
    129502349
   04730 Long-term depression
    129502349
   04723 Retrograde endocannabinoid signaling
    129502349
   04722 Neurotrophin signaling pathway
    129502349
  09158 Development and regeneration
   04360 Axon guidance
    129502349
   04380 Osteoclast differentiation
    129502349
  09159 Environmental adaptation
   04713 Circadian entrainment
    129502349
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129502349
   05206 MicroRNAs in cancer
    129502349
   05205 Proteoglycans in cancer
    129502349
   05207 Chemical carcinogenesis - receptor activation
    129502349
   05208 Chemical carcinogenesis - reactive oxygen species
    129502349
   05203 Viral carcinogenesis
    129502349
   05230 Central carbon metabolism in cancer
    129502349
   05231 Choline metabolism in cancer
    129502349
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129502349
  09162 Cancer: specific types
   05210 Colorectal cancer
    129502349
   05212 Pancreatic cancer
    129502349
   05225 Hepatocellular carcinoma
    129502349
   05226 Gastric cancer
    129502349
   05214 Glioma
    129502349
   05216 Thyroid cancer
    129502349
   05221 Acute myeloid leukemia
    129502349
   05220 Chronic myeloid leukemia
    129502349
   05218 Melanoma
    129502349
   05211 Renal cell carcinoma
    129502349
   05219 Bladder cancer
    129502349
   05215 Prostate cancer
    129502349
   05213 Endometrial cancer
    129502349
   05224 Breast cancer
    129502349
   05223 Non-small cell lung cancer
    129502349
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129502349
   05170 Human immunodeficiency virus 1 infection
    129502349
   05161 Hepatitis B
    129502349
   05160 Hepatitis C
    129502349
   05171 Coronavirus disease - COVID-19
    129502349
   05164 Influenza A
    129502349
   05163 Human cytomegalovirus infection
    129502349
   05167 Kaposi sarcoma-associated herpesvirus infection
    129502349
   05165 Human papillomavirus infection
    129502349
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129502349
   05135 Yersinia infection
    129502349
   05133 Pertussis
    129502349
   05152 Tuberculosis
    129502349
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    129502349
   05140 Leishmaniasis
    129502349
   05142 Chagas disease
    129502349
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129502349
   05020 Prion disease
    129502349
   05022 Pathways of neurodegeneration - multiple diseases
    129502349
  09165 Substance dependence
   05034 Alcoholism
    129502349
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129502349
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    129502349
   04933 AGE-RAGE signaling pathway in diabetic complications
    129502349
   04934 Cushing syndrome
    129502349
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129502349
   01524 Platinum drug resistance
    129502349
   01522 Endocrine resistance
    129502349
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:npo01001]
    129502349
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npo03036]
    129502349
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npo04147]
    129502349
Enzymes [BR:npo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     129502349
Protein kinases [BR:npo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   129502349
Chromosome and associated proteins [BR:npo03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     129502349
Exosome [BR:npo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129502349
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 129502349
NCBI-ProteinID: XP_055169840
LinkDB
Position
Unknown
AA seq 380 aa
MAAAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYMELHYIGEGAYGMVSSA
YDHVRKVRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLDAMRDVY
IVQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGVLEAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggagccgatggg
gtcggcccgggggtctcgggggaggtggaggtggtgaaggggcagccgttcgacgtgggc
ccgcgctacatggagctgcactacatcggcgagggtgcgtacggcatggtcagctcagct
tacgaccacgtgcgcaaggttcgcgtggccatcaagaaaatcagcccctttgagcatcag
acctactgccagcgcacactgagggagatccagatcttgctgcgcttccgccatgagaac
gtcattggcattcgggacattctgcgggcgcccaccctggacgccatgagggatgtctac
atcgtgcaggacctgatggagacggacctatacaagttgctcaaaagccagcagctgagc
aacgaccatgtttgctacttcctctaccagatcctgcgaggcctcaagtatatccactca
gccaatgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgac
cttaagatctgcgattttggcctggcccggattgccgatcctgagcatgaccacactggc
ttcctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactct
aagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctc
tccaaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctaggt
atcctaggctccccatcccaggaggacttgaactgtatcatcaatatgaaggcccgaaac
tacctacagtctctgccctccaagaccaaggtggcatgggccaagctttttcccaagtca
gactccaaagcccttgacctgctagaccggatgttgacctttaaccccaacaaacggatt
acagtggaagaagcactggctcatccctacttggagcagtactacgacccaacagatgag
ccagtggctgaggagcctttcactttcgacatggagctggatgatctacccaaggagcgt
ctgaaggagctcatcttccaggagacagcccgcttccagcctggggtgctggaagccccc
tag

DBGET integrated database retrieval system