Nyctereutes procyonoides (raccoon dog): 129505356 Help Entry 129505356         CDS       T09008                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04081   Hormone signaling npo04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     129505356 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     129505356 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129505356 (GAST) Cytokines and neuropeptides [BR:npo04052]  Neuropeptides   GPCR binding    129505356 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PsbT Motif Other DBs NCBI-GeneID:  129505356 NCBI-ProteinID:  XP_055174348 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQRLCVYVLILALALATFSEASWKPRSWLQDAPSGPGANRGLEPHGLDQLGPASHHRRQL GLQGPPQLVADLSKKQGPWMEEEEAAYGWMDFGRRSAEEEDQRP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactatgtgtgtacgtactgatcttggcactggctctggccaccttctctgaa gcttcttggaagccccgctcctggctgcaagatgcaccctcgggtccaggagcaaatagg ggtctggagccacatgggctggaccaactgggcccagcctctcaccaccgaaggcagcta gggctccagggtcccccacagctggtggcagacctgtccaagaagcagggaccgtggatg gaagaagaagaagcagcatacggatggatggacttcggccgccgcagtgctgaggaagag gaccaacgtccctag

DBGET integrated database retrieval system