Nyctereutes procyonoides (raccoon dog): 129507384 Help Entry 129507384         CDS       T09008                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04015   Rap1 signaling pathway npo04810   Regulation of actin cytoskeleton npo05014   Amyotrophic lateral sclerosis npo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     129507384 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129507384 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129507384 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129507384 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129507384 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:npo04812]     129507384 (PFN2)    04147 Exosome [BR:npo04147]     129507384 (PFN2) Membrane trafficking [BR:npo04131]  Others   Actin-binding proteins    Others     129507384 (PFN2) Cytoskeleton proteins [BR:npo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      129507384 (PFN2) Exosome [BR:npo04147]  Exosomal proteins   Proteins found in most exosomes    129507384 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  129507384 NCBI-ProteinID:  XP_055177735 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatacgtc gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system