Nyctereutes procyonoides (raccoon dog): 129507618 Help Entry 129507618         CDS       T09008                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04613   Neutrophil extracellular trap formation npo05034   Alcoholism npo05203   Viral carcinogenesis npo05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:npo00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129507618  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     129507618   09163 Immune disease    05322 Systemic lupus erythematosus     129507618   09165 Substance dependence    05034 Alcoholism     129507618  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npo03036]     129507618 Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129507618 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  129507618 NCBI-ProteinID:  XP_055178113 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaaggggctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaaacccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctcgggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system