Nyctereutes procyonoides (raccoon dog): 129509929 Help Entry 129509929         CDS       T09008                                  Name (RefSeq) regakine-1-like   KO K05408   C-C motif chemokine 3 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04060   Cytokine-cytokine receptor interaction npo04061   Viral protein interaction with cytokine and cytokine receptor npo04062   Chemokine signaling pathway npo04620   Toll-like receptor signaling pathway npo05142   Chagas disease npo05163   Human cytomegalovirus infection npo05323   Rheumatoid arthritis npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129509929    04061 Viral protein interaction with cytokine and cytokine receptor     129509929  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129509929    04062 Chemokine signaling pathway     129509929  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     129509929   09174 Infectious disease: parasitic    05142 Chagas disease     129509929   09163 Immune disease    05323 Rheumatoid arthritis     129509929   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129509929  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129509929    00536 Glycosaminoglycan binding proteins [BR:npo00536]     129509929 Cytokines and neuropeptides [BR:npo04052]  Cytokines   Chemokines    129509929 Glycosaminoglycan binding proteins [BR:npo00536]  Heparan sulfate / Heparin   Chemokines    129509929 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  129509929 NCBI-ProteinID:  XP_055181822 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MKVSLIALVFLLILAALHSEANEEPVNELTISPCCLAFISRRVPLRFVKGYQRTGDHCLT PGIIFLTHKGRQICANPSDAWVQEYIRHLDSLPK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcagcctcattgccctggtcttcctcctcattcttgctgccctccactctgag gccaatgaagaaccagttaatgaattaacaatcagtccatgctgtttggccttcatctca cggagagtcccactccggtttgtgaaaggttatcagagaaccggtgaccattgcctcacc ccagggatcattttccttacccacaagggcagacagatctgtgccaaccccagtgatgcc tgggtgcaggagtacatcagacacctagactctctgccaaagtga

DBGET integrated database retrieval system