Nyctereutes procyonoides (raccoon dog): 129510783 Help Entry 129510783         CDS       T09008                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04015   Rap1 signaling pathway npo04810   Regulation of actin cytoskeleton npo05014   Amyotrophic lateral sclerosis npo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     129510783 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129510783 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129510783 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129510783 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129510783 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:npo04812]     129510783 (PFN4)    04147 Exosome [BR:npo04147]     129510783 (PFN4) Membrane trafficking [BR:npo04131]  Others   Actin-binding proteins    Others     129510783 (PFN4) Cytoskeleton proteins [BR:npo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      129510783 (PFN4) Exosome [BR:npo04147]  Exosomal proteins   Proteins found in most exosomes    129510783 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  129510783 NCBI-ProteinID:  XP_055182984 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLHERSLCVASPGFSVMPGDVRTLVNGFAKNPLQTR REGLYFKEKDYKCIRADDYSLYAKNEKTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcacttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagcactcatcaaactccacgagagaagcttgtgtgtggcatcgccaggatttagtgta atgcctggtgatgtccgaacacttgtgaatggattcgccaagaaccctttacaaaccaga agagaaggattgtatttcaaggaaaaggactacaaatgtatccgggcagatgactattct ctttatgctaagaatgaaaaaactggtgtggtggttgtgaagacccatctgtatcttctg gtggcaacttacaccgaaggcatgtatcctagtgtttgtgtggaagccacagagaagctg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system