Nyctereutes procyonoides (raccoon dog): 129511712 Help Entry 129511712         CDS       T09008                                  Symbol CALM2 Name (RefSeq) calmodulin-2 isoform X1   KO K02183   calmodulin Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04014   Ras signaling pathway npo04015   Rap1 signaling pathway npo04020   Calcium signaling pathway npo04022   cGMP-PKG signaling pathway npo04024   cAMP signaling pathway npo04070   Phosphatidylinositol signaling system npo04114   Oocyte meiosis npo04218   Cellular senescence npo04261   Adrenergic signaling in cardiomyocytes npo04270   Vascular smooth muscle contraction npo04371   Apelin signaling pathway npo04625   C-type lectin receptor signaling pathway npo04713   Circadian entrainment npo04720   Long-term potentiation npo04722   Neurotrophin signaling pathway npo04728   Dopaminergic synapse npo04740   Olfactory transduction npo04744   Phototransduction npo04750   Inflammatory mediator regulation of TRP channels npo04910   Insulin signaling pathway npo04912   GnRH signaling pathway npo04915   Estrogen signaling pathway npo04916   Melanogenesis npo04921   Oxytocin signaling pathway npo04922   Glucagon signaling pathway npo04924   Renin secretion npo04925   Aldosterone synthesis and secretion npo04970   Salivary secretion npo04971   Gastric acid secretion npo05010   Alzheimer disease npo05012   Parkinson disease npo05022   Pathways of neurodegeneration - multiple diseases npo05031   Amphetamine addiction npo05034   Alcoholism npo05133   Pertussis npo05152   Tuberculosis npo05163   Human cytomegalovirus infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05170   Human immunodeficiency virus 1 infection npo05200   Pathways in cancer npo05214   Glioma npo05417   Lipid and atherosclerosis npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129511712 (CALM2)    04015 Rap1 signaling pathway     129511712 (CALM2)    04371 Apelin signaling pathway     129511712 (CALM2)    04020 Calcium signaling pathway     129511712 (CALM2)    04070 Phosphatidylinositol signaling system     129511712 (CALM2)    04024 cAMP signaling pathway     129511712 (CALM2)    04022 cGMP-PKG signaling pathway     129511712 (CALM2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129511712 (CALM2)    04218 Cellular senescence     129511712 (CALM2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129511712 (CALM2)   09152 Endocrine system    04910 Insulin signaling pathway     129511712 (CALM2)    04922 Glucagon signaling pathway     129511712 (CALM2)    04912 GnRH signaling pathway     129511712 (CALM2)    04915 Estrogen signaling pathway     129511712 (CALM2)    04921 Oxytocin signaling pathway     129511712 (CALM2)    04916 Melanogenesis     129511712 (CALM2)    04924 Renin secretion     129511712 (CALM2)    04925 Aldosterone synthesis and secretion     129511712 (CALM2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129511712 (CALM2)    04270 Vascular smooth muscle contraction     129511712 (CALM2)   09154 Digestive system    04970 Salivary secretion     129511712 (CALM2)    04971 Gastric acid secretion     129511712 (CALM2)   09156 Nervous system    04728 Dopaminergic synapse     129511712 (CALM2)    04720 Long-term potentiation     129511712 (CALM2)    04722 Neurotrophin signaling pathway     129511712 (CALM2)   09157 Sensory system    04744 Phototransduction     129511712 (CALM2)    04740 Olfactory transduction     129511712 (CALM2)    04750 Inflammatory mediator regulation of TRP channels     129511712 (CALM2)   09159 Environmental adaptation    04713 Circadian entrainment     129511712 (CALM2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129511712 (CALM2)   09162 Cancer: specific types    05214 Glioma     129511712 (CALM2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129511712 (CALM2)    05163 Human cytomegalovirus infection     129511712 (CALM2)    05167 Kaposi sarcoma-associated herpesvirus infection     129511712 (CALM2)   09171 Infectious disease: bacterial    05133 Pertussis     129511712 (CALM2)    05152 Tuberculosis     129511712 (CALM2)   09164 Neurodegenerative disease    05010 Alzheimer disease     129511712 (CALM2)    05012 Parkinson disease     129511712 (CALM2)    05022 Pathways of neurodegeneration - multiple diseases     129511712 (CALM2)   09165 Substance dependence    05031 Amphetamine addiction     129511712 (CALM2)    05034 Alcoholism     129511712 (CALM2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129511712 (CALM2)    05418 Fluid shear stress and atherosclerosis     129511712 (CALM2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:npo01009]     129511712 (CALM2)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129511712 (CALM2)    03036 Chromosome and associated proteins [BR:npo03036]     129511712 (CALM2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129511712 (CALM2) Protein phosphatases and associated proteins [BR:npo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129511712 (CALM2) Membrane trafficking [BR:npo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129511712 (CALM2) Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129511712 (CALM2) Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129511712 (CALM2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Dockerin_1 Caleosin FCaBP_EF-hand DUF5580_M TerB DUF1103 Poly_export SPEF2_C SurA_N_3 Fe_hyd_lg_C PA_Ig-like Motif Other DBs NCBI-GeneID:  129511712 NCBI-ProteinID:  XP_055184620 LinkDB All DBs Position Unknown AA seq 163 aa AA seqDB search MNQRRNSINCERNKGADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTE AELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAEL RHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgaaccagaggaggaattccatcaattgtgagagaaataaaggagctgaccaactgact gaggagcagattgcagaattcaaagaagccttttcactatttgacaaggatggtgatgga actataacaacaaaggaattgggaactgtaatgaggtctcttgggcagaatcccacagaa gcagagttacaggacatgattaatgaagtagatgctgatgggaatggcacaattgacttc ccggaatttctgacaatgatggcaagaaaaatgaaagacacagatagtgaagaagaaatt agagaagcattccgtgtgtttgataaggatggcaatggctatattagtgcagcagagctt cgccatgtgatgacaaacctgggagagaagttaacagatgaagaggttgatgaaatgatc agggaagcagatattgatggtgatggtcaagtaaactatgaagagtttgtacaaatgatg acagcaaagtga

DBGET integrated database retrieval system