Nyctereutes procyonoides (raccoon dog): 129512954 Help Entry 129512954         CDS       T09008                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo03008   Ribosome biogenesis in eukaryotes npo03083   Polycomb repressive complex npo04064   NF-kappa B signaling pathway npo04137   Mitophagy - animal npo04310   Wnt signaling pathway npo04520   Adherens junction npo05010   Alzheimer disease npo05020   Prion disease npo05022   Pathways of neurodegeneration - multiple diseases npo05162   Measles npo05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:npo00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     129512954 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     129512954 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     129512954 (CSNK2B)    04064 NF-kappa B signaling pathway     129512954 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     129512954 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     129512954 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129512954 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     129512954 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     129512954 (CSNK2B)    05020 Prion disease     129512954 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     129512954 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:npo03009]     129512954 (CSNK2B)    03036 Chromosome and associated proteins [BR:npo03036]     129512954 (CSNK2B) Ribosome biogenesis [BR:npo03009]  Eukaryotic type   90S particles    Kinase     129512954 (CSNK2B) Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      129512954 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  129512954 NCBI-ProteinID:  XP_055186526 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcttggatatcctggttctgtgggctccgtggcaatgaa ttcttttgtgaagtggatgaagactacatccaggataaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctctagacatgatcttggacctggagcctgatgaa gagctggaagacaaccccaaccagagcgacctgattgagcaggcagccgagatgctttat ggattgatccacgcccgctatatcctcaccaaccgtggcatcgcccagatgttggaaaag taccagcagggagactttggctactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcggacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccatcacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagcggcccgcg aaccagtttgtgcccaggctctacggtttcaagatccatccaatggcctaccagctgcag ctccaggccgccagcaacttcaagagcccagtcaagacgattcgctga

DBGET integrated database retrieval system