Nyctereutes procyonoides (raccoon dog): 129513058 Help Entry 129513058         CDS       T09008                                  Symbol TAC4 Name (RefSeq) tachykinin-4   KO K05241   tachykinin 4 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04080   Neuroactive ligand-receptor interaction npo04082   Neuroactive ligand signaling Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     129513058 (TAC4)    04082 Neuroactive ligand signaling     129513058 (TAC4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129513058 (TAC4) Cytokines and neuropeptides [BR:npo04052]  Neuropeptides   GPCR binding    129513058 (TAC4) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  129513058 NCBI-ProteinID:  XP_055186711 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MLLCVPLLLLMGLSACTGTAAEDLAVGAEAGSWITLTLEDGGIPGIQLQLQLQEVKRGKA SQFFGLMGKRVGGREDEDQGPE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgcgtccccctgcttctcctgatggggctgtctgcatgcactgggacagct gccgaggacctggcagtgggagctgaagcagggtcctggataaccttgaccctggaggac ggtggcatcccaggcattcagctccagctccagctccaggaggtgaagaggggcaaagca agccagttctttgggctgatggggaagcgggtgggaggcagagaggatgaggaccagggg ccagagtga

DBGET integrated database retrieval system