Nyctereutes procyonoides (raccoon dog): 129513313 Help Entry 129513313         CDS       T09008                                  Name (RefSeq) cofilin-1-like   KO K05765   cofilin Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04360   Axon guidance npo04666   Fc gamma R-mediated phagocytosis npo04810   Regulation of actin cytoskeleton npo05133   Pertussis npo05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:npo00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129513313  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     129513313   09158 Development and regeneration    04360 Axon guidance     129513313  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129513313   09171 Infectious disease: bacterial    05133 Pertussis     129513313  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129513313   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:npo04812]     129513313    04147 Exosome [BR:npo04147]     129513313 Membrane trafficking [BR:npo04131]  Others   Actin-binding proteins    Others     129513313 Cytoskeleton proteins [BR:npo04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      129513313 Exosome [BR:npo04147]  Exosomal proteins   Proteins found in most exosomes    129513313 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  129513313 NCBI-ProteinID:  XP_055187030 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MASGVVVSDSVIKMFNDMKVPKSSTPEEVKKHKKAVLFFLSEDKKDIILEEGKEKLVGDV SRTVDDLYAILVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPDSALLKSKMIYARS KDAIKKKRTGIMHEL NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggcctctggggtggtggtttctgacagtgtcatcaaaatgttcaatgacatgaaggtg cctaagtcctcaacaccagaggaggtgaagaagcacaagaaggcagtacttttcttcctg agcgaggacaagaaggacatcatcctcgaggagggcaaggagaaactggtaggtgatgtg agccggactgtagacgacctctacgccatccttgtcaagatgctaccagacaaggactgc cgctatgccctctatgatgcaacctacgagaccaaggagagcaagaaggaggacctggtg tttatcttctgggcacctgactctgcactccttaagagcaaaatgatttatgccagatcc aaggatgccatcaagaaaaagaggaccgggatcatgcatgaattataa

DBGET integrated database retrieval system