Nyctereutes procyonoides (raccoon dog): 129513685 Help Entry 129513685         CDS       T09008                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04014   Ras signaling pathway npo04015   Rap1 signaling pathway npo04020   Calcium signaling pathway npo04022   cGMP-PKG signaling pathway npo04024   cAMP signaling pathway npo04070   Phosphatidylinositol signaling system npo04114   Oocyte meiosis npo04218   Cellular senescence npo04261   Adrenergic signaling in cardiomyocytes npo04270   Vascular smooth muscle contraction npo04371   Apelin signaling pathway npo04625   C-type lectin receptor signaling pathway npo04713   Circadian entrainment npo04720   Long-term potentiation npo04722   Neurotrophin signaling pathway npo04728   Dopaminergic synapse npo04740   Olfactory transduction npo04744   Phototransduction npo04750   Inflammatory mediator regulation of TRP channels npo04910   Insulin signaling pathway npo04912   GnRH signaling pathway npo04915   Estrogen signaling pathway npo04916   Melanogenesis npo04921   Oxytocin signaling pathway npo04922   Glucagon signaling pathway npo04924   Renin secretion npo04925   Aldosterone synthesis and secretion npo04970   Salivary secretion npo04971   Gastric acid secretion npo05010   Alzheimer disease npo05012   Parkinson disease npo05022   Pathways of neurodegeneration - multiple diseases npo05031   Amphetamine addiction npo05034   Alcoholism npo05133   Pertussis npo05152   Tuberculosis npo05163   Human cytomegalovirus infection npo05167   Kaposi sarcoma-associated herpesvirus infection npo05170   Human immunodeficiency virus 1 infection npo05200   Pathways in cancer npo05214   Glioma npo05417   Lipid and atherosclerosis npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129513685    04015 Rap1 signaling pathway     129513685    04371 Apelin signaling pathway     129513685    04020 Calcium signaling pathway     129513685    04070 Phosphatidylinositol signaling system     129513685    04024 cAMP signaling pathway     129513685    04022 cGMP-PKG signaling pathway     129513685  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129513685    04218 Cellular senescence     129513685  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129513685   09152 Endocrine system    04910 Insulin signaling pathway     129513685    04922 Glucagon signaling pathway     129513685    04912 GnRH signaling pathway     129513685    04915 Estrogen signaling pathway     129513685    04921 Oxytocin signaling pathway     129513685    04916 Melanogenesis     129513685    04924 Renin secretion     129513685    04925 Aldosterone synthesis and secretion     129513685   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129513685    04270 Vascular smooth muscle contraction     129513685   09154 Digestive system    04970 Salivary secretion     129513685    04971 Gastric acid secretion     129513685   09156 Nervous system    04728 Dopaminergic synapse     129513685    04720 Long-term potentiation     129513685    04722 Neurotrophin signaling pathway     129513685   09157 Sensory system    04744 Phototransduction     129513685    04740 Olfactory transduction     129513685    04750 Inflammatory mediator regulation of TRP channels     129513685   09159 Environmental adaptation    04713 Circadian entrainment     129513685  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129513685   09162 Cancer: specific types    05214 Glioma     129513685   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129513685    05163 Human cytomegalovirus infection     129513685    05167 Kaposi sarcoma-associated herpesvirus infection     129513685   09171 Infectious disease: bacterial    05133 Pertussis     129513685    05152 Tuberculosis     129513685   09164 Neurodegenerative disease    05010 Alzheimer disease     129513685    05012 Parkinson disease     129513685    05022 Pathways of neurodegeneration - multiple diseases     129513685   09165 Substance dependence    05031 Amphetamine addiction     129513685    05034 Alcoholism     129513685   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129513685    05418 Fluid shear stress and atherosclerosis     129513685  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:npo01009]     129513685   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129513685    03036 Chromosome and associated proteins [BR:npo03036]     129513685   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129513685 Protein phosphatases and associated proteins [BR:npo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129513685 Membrane trafficking [BR:npo04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129513685 Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129513685 Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129513685 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 Dockerin_1 EF_EFCAB10_C EH Temptin_C EF-hand_11 EFhand_Ca_insen DUF5580_M Caleosin SurA_N_3 SurA_N_2 Motif Other DBs NCBI-GeneID:  129513685 NCBI-ProteinID:  XP_055187921 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MANQLSEEQVAEFKEAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDE EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccaaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt gacaaggacggggacggggccatcaccacccaggagctgggcaccgtcatgcgctccctg ggccagaaccccacggaggccgagctgcgggacatggtgggcgagatcgaccgggacggc aacggctccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg gacagcgaggagcagatccgggaggccttccgcgtcttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcggcacgtgatgaccaggctgggggagaagctgagtgacgag gaggtggacgagatgatccgggccgccgacgtggacggggacgggcaggtgaactacgag gagttcgtccacatgctggtgtccaagtga

DBGET integrated database retrieval system