Nyctereutes procyonoides (raccoon dog): 129514525 Help Entry 129514525         CDS       T09008                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04613   Neutrophil extracellular trap formation npo05034   Alcoholism npo05202   Transcriptional misregulation in cancer npo05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:npo00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129514525  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129514525   09163 Immune disease    05322 Systemic lupus erythematosus     129514525   09165 Substance dependence    05034 Alcoholism     129514525  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npo03036]     129514525   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129514525 Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129514525 Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129514525 SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  129514525 NCBI-ProteinID:  XP_055189125 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTACKSTGGKAPRKQLATKAARKSAPSTGGVRKPHRYRPGTVALHEIRRYQKSTE LLIRKFPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHVKHVTI MPKDIQLARCIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcctgcaaatcgaccggtggtaaagcaccaaggaagcaa ctggctacaaaagccgctcgcaagagtgcaccctctactggaggggtgaggaaacctcat cgttacaggcctggtactgtggcactccatgaaattagacgttatcagaagtccactgaa cttctgatccgcaaatttcctttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagtgcagctattggtgctttgcaggaggcaagtgaggcctat ctggtgggcctctttgaagacaccaacctgtgtgctatccatgtcaaacatgtcacaatt atgccaaaagacatccagctagcacgctgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system