Nyctereutes procyonoides (raccoon dog): 129514823 Help Entry 129514823         CDS       T09008                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04382   Cornified envelope formation npo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npo00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     129514823  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129514823  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129514823 Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of microglial cells    129514823 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_7 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  129514823 NCBI-ProteinID:  XP_055189501 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MPSQMEHAMETMMFMFHKFAGEKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMDLDQ CRDGKVGFQIFFSLIAGLTIACNDYFVIYMKQKAKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacatgccatggaaaccatgatgttcatgtttcacaaatttgct ggggagaaaggatacttgacaaaggaagacctgagggtactcatggaaaaggaattccca ggatttttggaaaatcagaaagaccctctagccgtggacaaaataatggacctcgaccag tgccgagatggcaaagtgggcttccagatcttcttttcgctaattgctgggctcaccatc gcatgcaatgactattttgtaatatacatgaagcagaaggccaagaaatag

DBGET integrated database retrieval system