Nyctereutes procyonoides (raccoon dog): 129515281 Help Entry 129515281         CDS       T09008                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo00190   Oxidative phosphorylation npo01100   Metabolic pathways npo01524   Platinum drug resistance npo04115   p53 signaling pathway npo04210   Apoptosis npo04215   Apoptosis - multiple species npo04932   Non-alcoholic fatty liver disease npo05010   Alzheimer disease npo05012   Parkinson disease npo05014   Amyotrophic lateral sclerosis npo05016   Huntington disease npo05017   Spinocerebellar ataxia npo05020   Prion disease npo05022   Pathways of neurodegeneration - multiple diseases npo05132   Salmonella infection npo05134   Legionellosis npo05145   Toxoplasmosis npo05152   Tuberculosis npo05160   Hepatitis C npo05161   Hepatitis B npo05162   Measles npo05163   Human cytomegalovirus infection npo05164   Influenza A npo05167   Kaposi sarcoma-associated herpesvirus infection npo05168   Herpes simplex virus 1 infection npo05169   Epstein-Barr virus infection npo05170   Human immunodeficiency virus 1 infection npo05200   Pathways in cancer npo05210   Colorectal cancer npo05222   Small cell lung cancer npo05416   Viral myocarditis npo05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     129515281  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129515281    04215 Apoptosis - multiple species     129515281    04115 p53 signaling pathway     129515281  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129515281   09162 Cancer: specific types    05210 Colorectal cancer     129515281    05222 Small cell lung cancer     129515281   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129515281    05161 Hepatitis B     129515281    05160 Hepatitis C     129515281    05164 Influenza A     129515281    05162 Measles     129515281    05168 Herpes simplex virus 1 infection     129515281    05163 Human cytomegalovirus infection     129515281    05167 Kaposi sarcoma-associated herpesvirus infection     129515281    05169 Epstein-Barr virus infection     129515281   09171 Infectious disease: bacterial    05132 Salmonella infection     129515281    05134 Legionellosis     129515281    05152 Tuberculosis     129515281   09174 Infectious disease: parasitic    05145 Toxoplasmosis     129515281   09164 Neurodegenerative disease    05010 Alzheimer disease     129515281    05012 Parkinson disease     129515281    05014 Amyotrophic lateral sclerosis     129515281    05016 Huntington disease     129515281    05017 Spinocerebellar ataxia     129515281    05020 Prion disease     129515281    05022 Pathways of neurodegeneration - multiple diseases     129515281   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129515281    05416 Viral myocarditis     129515281   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     129515281   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     129515281 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_C Cytochrom_C550 Cytochrome_CBB3 CCP_MauG Motif Other DBs NCBI-GeneID:  129515281 NCBI-ProteinID:  XP_055190066 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGPKTGQAPGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGLKKTGERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcgcagtgccatact gtggaaaagggaggcaagcacaagactgggccaaacctccacggtttatttgggccgaag accggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg ggagaggagaccctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa atgatcttcgctggccttaagaagacaggggaaagagcagacttaatagcttatctcaaa aaagctaccaatgagtaa

DBGET integrated database retrieval system