Nyctereutes procyonoides (raccoon dog): 129515866 Help Entry 129515866         CDS       T09008                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04072   Phospholipase D signaling pathway npo04140   Autophagy - animal npo04150   mTOR signaling pathway npo04151   PI3K-Akt signaling pathway npo04152   AMPK signaling pathway npo04211   Longevity regulating pathway npo04218   Cellular senescence npo04714   Thermogenesis npo04910   Insulin signaling pathway npo04919   Thyroid hormone signaling pathway npo05163   Human cytomegalovirus infection npo05165   Human papillomavirus infection npo05168   Herpes simplex virus 1 infection npo05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     129515866 (RHEB)    04151 PI3K-Akt signaling pathway     129515866 (RHEB)    04152 AMPK signaling pathway     129515866 (RHEB)    04150 mTOR signaling pathway     129515866 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129515866 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     129515866 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     129515866 (RHEB)    04919 Thyroid hormone signaling pathway     129515866 (RHEB)   09149 Aging    04211 Longevity regulating pathway     129515866 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     129515866 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     129515866 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     129515866 (RHEB)    05163 Human cytomegalovirus infection     129515866 (RHEB)    05165 Human papillomavirus infection     129515866 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:npo04031]     129515866 (RHEB) GTP-binding proteins [BR:npo04031]  Small (monomeric) G-proteins   Ras Family    Rheb     129515866 (RHEB) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  129515866 NCBI-ProteinID:  XP_055190972 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacgattcagtttgttgaaggccaatttgttgactcctacgacccaaccatagaa aacactttcacaaaattgatcacagtcaatggacaagaatatcatcttcaacttgtcgac acagccgggcaagatgaatactccatctttcctcagacatactccatagatattaatggt tatattcttgtgtattctgttacatcaatcaaaagttttgaagtgattaaagttattcat ggcaaattgttggacatggtggggaaagtgcaaatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcgttagcagagtct tggaacgccgcttttttggaatcttctgctaaagaaaatcagacggctgttgatgttttt agaaggataattttggaggcagaaaaaatcgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtaa

DBGET integrated database retrieval system