Nyctereutes procyonoides (raccoon dog): 129516528 Help Entry 129516528         CDS       T09008                                  Symbol CENPX Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:npo00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     129516528 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:npo03400]     129516528 (CENPX) DNA repair and recombination proteins [BR:npo03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      129516528 (CENPX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X HEAT_ULK4 CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  129516528 NCBI-ProteinID:  XP_055191939 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MEATGGGFRKELVSKLLQMHFTDSKTKVSGDALRLMAELLTIFVVEAAIRSVRQAQAEDL ALVDVDQLEKVLPQLLLDF NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaggcaactggcggcggcttccggaaggaactggtgagcaagctgttgcagatgcac tttacggacagtaagaccaaagtcagtggggatgcgctaaggctcatggcggagctgctg accatcttcgttgtggaagcagctatccgcagcgtccgacaggcccaggcagaggacctg gctcttgtggatgtggaccagctggagaaggtgctgcctcagctgctcctggacttctag

DBGET integrated database retrieval system