Nyctereutes procyonoides (raccoon dog): 129517291 Help Entry 129517291         CDS       T09008                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04014   Ras signaling pathway npo04137   Mitophagy - animal npo04144   Endocytosis npo04145   Phagosome npo04148   Efferocytosis npo04962   Vasopressin-regulated water reabsorption npo05132   Salmonella infection npo05146   Amoebiasis npo05152   Tuberculosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129517291 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129517291 (RAB5C)    04145 Phagosome     129517291 (RAB5C)    04137 Mitophagy - animal     129517291 (RAB5C)    04148 Efferocytosis     129517291 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     129517291 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129517291 (RAB5C)    05152 Tuberculosis     129517291 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     129517291 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129517291 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129517291 (RAB5C)    04031 GTP-binding proteins [BR:npo04031]     129517291 (RAB5C) Membrane trafficking [BR:npo04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     129517291 (RAB5C)  Endosome - Lysosome transport     129517291 (RAB5C) Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129517291 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    129517291 (RAB5C)   Exosomal proteins of colorectal cancer cells    129517291 (RAB5C)   Exosomal proteins of bladder cancer cells    129517291 (RAB5C) GTP-binding proteins [BR:npo04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     129517291 (RAB5C) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  129517291 NCBI-ProteinID:  XP_055192968 LinkDB All DBs Position Unknown AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPSRNRGVDLQENSPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcgcgacccaatggaccagctgctgggaacaagatctgt caattcaagctggtcctgctcggggaatctgcagtgggcaaatctagcctcgtccttcgc ttcgtcaagggacagttccatgagtaccaggagagcacaattggagcggccttcctcaca cagacggtctgtttggacgacacaacagtcaaatttgagatctgggacacagctggacag gagcggtatcacagcctggcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaacacagatacatttgcacgggccaagaactgggtgaaggagctacag aggcaggccagccccaacatcgtcattgcactcgcggggaacaaggcagacctggccagc aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatccgcaaagactgcaatgaacgtgaatgaaattttcatggcaatagctaag aaacttcccaagaatgagccccagaatgcagctggtgccccgagccggaaccgaggggtg gacctccaggagaacagcccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system