Nyctereutes procyonoides (raccoon dog): 129519254 Help Entry 129519254         CDS       T09008                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04519   Cadherin signaling npo04810   Regulation of actin cytoskeleton npo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     129519254  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129519254  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129519254 SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 TMEM132_3rd Motif Other DBs NCBI-GeneID:  129519254 NCBI-ProteinID:  XP_055195607 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MAGQKDPVQWEIHQDWANRGYIAVITSSIKKIVDFLNSFDRSCSRLAKLNKKLTALEWRI EYIEAQVTKGETLT NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgggccaaaaggatccggtgcagtgggagattcaccaggactgggcgaaccgggga tacattgcggtcatcaccagcagcatcaagaagatcgtggactttctcaactcattcgat aggtcttgttcaagacttgcaaaactaaacaagaaattgacagccctcgagtggagaata gagtacattgaagcacaggtgacaaaaggtgagactctcacctag

DBGET integrated database retrieval system