Nyctereutes procyonoides (raccoon dog): 129519254 Help Entry 129519254         CDS       T09008                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04810   Regulation of actin cytoskeleton npo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npo00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129519254  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129519254 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 Motif Other DBs NCBI-GeneID:  129519254 NCBI-ProteinID:  XP_055195607 LinkDB All DBs Position Unknown AA seq 74 aa AA seqDB search MAGQKDPVQWEIHQDWANRGYIAVITSSIKKIVDFLNSFDRSCSRLAKLNKKLTALEWRI EYIEAQVTKGETLT NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgggccaaaaggatccggtgcagtgggagattcaccaggactgggcgaaccgggga tacattgcggtcatcaccagcagcatcaagaagatcgtggactttctcaactcattcgat aggtcttgttcaagacttgcaaaactaaacaagaaattgacagccctcgagtggagaata gagtacattgaagcacaggtgacaaaaggtgagactctcacctag

DBGET integrated database retrieval system