Nyctereutes procyonoides (raccoon dog): 129520093 Help Entry 129520093         CDS       T09008                                  Name (RefSeq) glutathione S-transferase P-like   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo00480   Glutathione metabolism npo00980   Metabolism of xenobiotics by cytochrome P450 npo00982   Drug metabolism - cytochrome P450 npo00983   Drug metabolism - other enzymes npo01100   Metabolic pathways npo01524   Platinum drug resistance npo05200   Pathways in cancer npo05204   Chemical carcinogenesis - DNA adducts npo05215   Prostate cancer npo05225   Hepatocellular carcinoma npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     129520093   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     129520093    00982 Drug metabolism - cytochrome P450     129520093    00983 Drug metabolism - other enzymes     129520093  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129520093    05204 Chemical carcinogenesis - DNA adducts     129520093   09162 Cancer: specific types    05225 Hepatocellular carcinoma     129520093    05215 Prostate cancer     129520093   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     129520093   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     129520093  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:npo02000]     129520093 Enzymes [BR:npo01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      129520093 Transporters [BR:npo02000]  Other transporters   Pores ion channels [TC:1]    129520093 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 GST_N_2 GST_N_3 Motif Other DBs NCBI-GeneID:  129520093 NCBI-ProteinID:  XP_055197036 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MPPYTIIYFPVRGRCEAMRMLLADQGQSWKEEVVTMETWMKGSLKASCLNGQLPKFQDGD LTLYQSNAILRHLGRSHGLYGKDQQEAALLDVVNDGVEDLRCKYALLIYTNYEAGKEEYV KALPGYLKPFETLLSQNEGGQAFIMCNQISFADYNLLDLLLIHQVLAPSCLDSFPLLSAY VARLSARPKLKAFLSYPEHVNRPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccaccctacaccatcatctatttccctgttcgagggcgctgtgaggccatgcgcatg ctgctggctgaccagggccagagctggaaggaggaggtggtgaccatggagacctggatg aagggctcactcaaggcctcctgtctgaacgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaatgccatcctgcgacacctgggccgctcccatgggctctat gggaaggaccagcaggaggcagccttgctggatgtagtgaacgatggtgtggaggatctc cgctgcaaatacgccctcctcatctacactaactatgaggcaggaaaggaggagtatgtg aaggcactaccaggttacctgaaaccttttgaaacactgttgtcccagaatgaggggggc caggccttcatcatgtgcaaccagatctccttcgcggactacaacctgctggacttgctg ctgattcaccaggtcctggcccccagctgcctggactccttccccctgctctcggcctat gtggcgcgcctcagcgccagacccaagctcaaggcattcctgtcgtaccccgagcacgtg aaccgccccatcaatggcaacgggaagcagtga

DBGET integrated database retrieval system