Nyctereutes procyonoides (raccoon dog): 129521549 Help Entry 129521549         CDS       T09008                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04137   Mitophagy - animal npo04140   Autophagy - animal npo04144   Endocytosis npo04145   Phagosome npo04148   Efferocytosis npo05132   Salmonella infection npo05146   Amoebiasis npo05152   Tuberculosis Brite KEGG Orthology (KO) [BR:npo00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129521549 (RAB7A)    04145 Phagosome     129521549 (RAB7A)    04140 Autophagy - animal     129521549 (RAB7A)    04137 Mitophagy - animal     129521549 (RAB7A)    04148 Efferocytosis     129521549 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129521549 (RAB7A)    05152 Tuberculosis     129521549 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     129521549 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129521549 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129521549 (RAB7A)    04031 GTP-binding proteins [BR:npo04031]     129521549 (RAB7A) Membrane trafficking [BR:npo04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129521549 (RAB7A) Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129521549 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    129521549 (RAB7A)   Exosomal proteins of colorectal cancer cells    129521549 (RAB7A)   Exosomal proteins of bladder cancer cells    129521549 (RAB7A) GTP-binding proteins [BR:npo04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129521549 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  129521549 NCBI-ProteinID:  XP_055199104 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagttggt aagacatcactcatgaaccagtatgtgaacaagaaattcagtaatcagtacaaagctaca ataggagcagactttctgacaaaggaggtgatggtggatgacagactagttacaatgcag atctgggacacagcaggccaggaacggttccagtcccttggtgtggccttctacagaggt gcagactgctgcgttctggtatttgacgttactgcccccaacacattcaaaaccctcgat agctggagagatgagtttctcatccaggccagtccccgggatcctgaaaacttccctttc gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aatgtggagcaggcgttccagacgattgcaaggaatgcacttaaacaggaaacagaggtg gagctgtacaatgaattccccgaacccatcaaactggataagaacgaccgggccaagacc tcagcggaaagctgcagttgctga

DBGET integrated database retrieval system