Nyctereutes procyonoides (raccoon dog): 129521621 Help Entry 129521621         CDS       T09008                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo04140   Autophagy - animal npo04144   Endocytosis npo04152   AMPK signaling pathway npo04530   Tight junction npo04972   Pancreatic secretion npo05014   Amyotrophic lateral sclerosis npo05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     129521621 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129521621 (RAB8A)    04140 Autophagy - animal     129521621 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     129521621 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     129521621 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129521621 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     129521621 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npo04131]     129521621 (RAB8A)    03036 Chromosome and associated proteins [BR:npo03036]     129521621 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npo04147]     129521621 (RAB8A)    04031 GTP-binding proteins [BR:npo04031]     129521621 (RAB8A) Membrane trafficking [BR:npo04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     129521621 (RAB8A)  Autophagy   Other autophagy associated proteins     129521621 (RAB8A) Chromosome and associated proteins [BR:npo03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     129521621 (RAB8A) Exosome [BR:npo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129521621 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    129521621 (RAB8A)   Exosomal proteins of colorectal cancer cells    129521621 (RAB8A) GTP-binding proteins [BR:npo04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     129521621 (RAB8A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  129521621 NCBI-ProteinID:  XP_055199233 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactcaactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacagcctattacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaatatccgg aactggattcggaacattgaagagcatgcttctgcagatgtcgaaaagatgatactcgga aacaagtgtgatgtgaacgacaaaagacaagtttccaaggaacggggagaaaagctggcc ctggactatggaatcaagttcatggagaccagtgcgaaggccaacatcaatgtggagaac gcatttttcactctcgccagagacatcaaagcaaaaatggacaaaaaattggaaggcaac agtccccaagggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system