Novosphingobium sp. PP1Y: PP1Y_Mpl10983 Help Entry PP1Y_Mpl10983     CDS       T01515                                  Name (GenBank) conserved hypothetical protein   KO K02078   acyl carrier protein Organism npp  Novosphingobium sp. PP1Y Pathway npp01100   Metabolic pathways npp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:npp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PP1Y_Mpl10983    00074 Mycolic acid biosynthesis     PP1Y_Mpl10983   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PP1Y_Mpl10983 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CCA90917 UniProt:  F6IF42 LinkDB All DBs Position Mpl:1092720..1092950 Genome browser AA seq 76 aa AA seqDB search MTNEDIMALISQETGLEREKLAPDATLATLDISSIDLVSVLFEIEDRFGVEIQPEDIPPE STLQQLIDRITTGAKA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt ttgacgaatgaagacatcatggccctgatttcgcaggaaaccggtctcgaacgcgaaaag ctggcgcctgacgccacgcttgccaccctcgacatatcctcgatagaccttgtgagcgtc ctgttcgagatcgaggaccgcttcggcgtcgagatccagcccgaagatattccccccgaa tccacccttcaacaactgatcgaccggatcacgaccggcgccaaggcatga

DBGET integrated database retrieval system