Nanorana parkeri (Xizang Plateau frog): 108784646 Help Entry 108784646         CDS       T04897                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04814   Motor proteins npr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     108784646 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108784646 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:npr03037]     108784646 (DYNLT3)    04812 Cytoskeleton proteins [BR:npr04812]     108784646 (DYNLT3) Cilium and associated proteins [BR:npr03037]  Motile cilia and associated proteins   Dynein arm    108784646 (DYNLT3) Cytoskeleton proteins [BR:npr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      108784646 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  108784646 NCBI-ProteinID:  XP_018409017 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MEDQNKAENTFSADEASSIVKECLDVILGGVDYDEGRVNEWMSAVVEQSLTHLVKLEKTF KYIVTCTVMQKRGGGLHSATSSFWDNTTDGSCTVRWENRTMYCIVNVFAVAIQL NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggaggatcagaacaaggcagagaacacattcagtgcagatgaagccagctccattgta aaagagtgtttagatgtcatcctgggtggagtggattacgatgaaggtcgagtcaatgag tggatgtctgctgtagtggaacagtcactaacccatctagtaaagttggaaaaaaccttt aagtatattgtaacctgtacagttatgcaaaaacgaggcggtggtcttcactcagcaacc tcctccttctgggataacaccactgatgggagttgcacagtgaggtgggaaaatcggacc atgtattgcatcgtgaatgtatttgctgttgctatacaactgtaa

DBGET integrated database retrieval system