Nanorana parkeri (Xizang Plateau frog): 108784979 Help Entry 108784979         CDS       T04897                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04137   Mitophagy - animal npr04140   Autophagy - animal npr04144   Endocytosis npr04145   Phagosome npr04148   Efferocytosis npr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108784979 (RAB7A)    04145 Phagosome     108784979 (RAB7A)    04140 Autophagy - animal     108784979 (RAB7A)    04137 Mitophagy - animal     108784979 (RAB7A)    04148 Efferocytosis     108784979 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108784979 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108784979 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108784979 (RAB7A)    04031 GTP-binding proteins [BR:npr04031]     108784979 (RAB7A) Membrane trafficking [BR:npr04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108784979 (RAB7A) Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108784979 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    108784979 (RAB7A)   Exosomal proteins of colorectal cancer cells    108784979 (RAB7A)   Exosomal proteins of bladder cancer cells    108784979 (RAB7A) GTP-binding proteins [BR:npr04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108784979 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW Septin nSTAND3 PduV-EutP AAA_7 AAA_22 AAA_24 AAA_16 AAA_5 NTPase_1 FLYWCH_N ATPase_2 SRPRB NB-ARC NACHT AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  108784979 NCBI-ProteinID:  XP_018409443 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFTNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQVWCHSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRSKGSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtccagaaagaaagtgcttctgaaggtcatcatcctgggggattctggggttggc aagacttctcttatgaaccaatatgttaataagaaatttactaaccagtacaaggccaca atcggggctgactttctgaccaaggaggtgatggtggatgaccggctggtcacaatgcag atatgggacacagctgggcaagagcggttccagtcacttggtgtggccttctaccggggg gcggactgctgcgttttggtgttcgatgtcactgcacccaacacgttcaaaaccttggac agctggagagatgaattcctcattcaggccagtccacgagaccctgaaaactttcccttc gtcgtcttgggaaataagatagaccttgaaaacagacaagtcaccacaaagcgagcacag gtctggtgtcatagcaaaaacaacatcccgtactttgaaaccagtgctaaagaggctatc aacgtggagcaggctttccagaccattgcacggaatgcacttaaacaggaaacagaggtg gagctctacaacgaattcccagagcccattaaactggacaagaacgaccggtcaaagggc tcggcagagagctgcagctgctga

DBGET integrated database retrieval system