Nanorana parkeri (Xizang Plateau frog): 108786235 Help Entry 108786235         CDS       T04897                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr03410   Base excision repair npr04140   Autophagy - animal npr04217   Necroptosis Brite KEGG Orthology (KO) [BR:npr00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     108786235 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108786235 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     108786235 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npr03036]     108786235 (HMGB1)    03400 DNA repair and recombination proteins [BR:npr03400]     108786235 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108786235 (HMGB1) Chromosome and associated proteins [BR:npr03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     108786235 (HMGB1) DNA repair and recombination proteins [BR:npr03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      108786235 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      108786235 (HMGB1) Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108786235 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 NOA36 DUF6699 Motif Other DBs NCBI-GeneID:  108786235 NCBI-ProteinID:  XP_018410988 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MGKGDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKF EDMAKVDKVRYEKEMKTYIPPKGESKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGL TIGDVAKKLGEMWNNTASEDKVPYEKKAAKLKEKYEKDVAAYRAKGKPEAPKKAPPKPEK SKKMEDDDDDDEDDEDEEDEEDEDDDEDDE NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggggaaaggtgatccaaagaaaccaagaggaaagatgtcctcttatgcttactttgtg caaacttgcagagaagagcacaagaaaaagcacccagatgcatctgtaaactttgccgag ttctccaagaagtgctccgagcgatggaagaccatgtccgctaaggaaaagggcaagttt gaagatatggctaaagtagataaagtccggtatgaaaaagaaatgaaaacttatatacca cccaaaggagaatccaaaaagaagttcaaggacccaaatgcaccaaagagaccaccatcg gctttcttcctgttctgttctgaattccgtcctaaaatcaaaggtgagcacccgggtttg accatcggagatgtggcaaagaaactaggagagatgtggaataacaccgcatctgaagac aaggtgccttatgaaaagaaagctgccaaactgaaggagaaatatgaaaaggatgttgca gcatatcgggccaaaggaaagcccgaagcacccaaaaaggcaccgcctaaacctgaaaag agcaagaaaatggaggatgatgatgatgatgacgaggatgatgaagatgaggaggacgag gaagatgaagatgatgatgaagatgatgagtaa

DBGET integrated database retrieval system