Nanorana parkeri (Xizang Plateau frog): 108786979 Help Entry 108786979         CDS       T04897                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04115   p53 signaling pathway npr04137   Mitophagy - animal npr04140   Autophagy - animal npr04210   Apoptosis npr04621   NOD-like receptor signaling pathway npr05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:npr00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108786979 (BCL2L1)    04137 Mitophagy - animal     108786979 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     108786979 (BCL2L1)    04115 p53 signaling pathway     108786979 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108786979 (BCL2L1)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     108786979 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:npr01009]     108786979 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npr03036]     108786979 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:npr02000]     108786979 (BCL2L1) Protein phosphatases and associated proteins [BR:npr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      108786979 (BCL2L1) Chromosome and associated proteins [BR:npr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     108786979 (BCL2L1) Transporters [BR:npr02000]  Other transporters   Pores ion channels [TC:1]    108786979 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bcl-2_3 GREB1_2nd Motif Other DBs NCBI-GeneID:  108786979 NCBI-ProteinID:  XP_018411911 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MEGGNKNLIQKFVCKKLSRKGFHPSCCTDIQSEIYANGSTPTDQVGTRLEESPPVPLTEE LLQALMDASEEFELRYIRAFNDLACQLHITPDTAYQSFEQVVHELFRDGINWGRIVAFFC FGGALCFESADKEMEELLPRIIQWMATYLDSSLEPWIQQNGGWEAFVSLYGNDAAAESRK SQERFGMWLLTGVTLAGFALLASYLIRR NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggaagggggcaacaaaaacctcatccaaaagtttgtgtgcaaaaaactttctcggaaa ggcttccaccccagttgctgcaccgatatccagtctgagatttacgcgaatggcagcacc ccaacagaccaggtcggcacccgcctggaagaaagcccgccggttcccttgaccgaagaa ttactgcaagctctgatggatgcatcggaagaatttgaactaagatatatacgtgcgttt aatgaccttgcttgccagctgcacatcaccccagacacggcatatcaaagctttgagcag gtggtgcatgaactgtttagggatggcataaactgggggcgtattgtggctttcttctgt tttgggggggcgctgtgctttgagagcgcagataaggaaatggaagaacttctccctagg attattcaatggatggcaacatatttggattcttctttagagccctggatacaacaaaac ggaggctgggaagcgttcgtcagtctgtatggaaacgacgccgctgccgagagcaggaaa agccaagaacgcttcgggatgtggctcctgacgggagtgacactggcaggattcgcccta ctggcctcttatctcatccgcagatag

DBGET integrated database retrieval system