Nanorana parkeri (Xizang Plateau frog): 108787622 Help Entry 108787622         CDS       T04897                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04621   NOD-like receptor signaling pathway npr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npr00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108787622  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108787622  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:npr03110]     108787622 Chaperones and folding catalysts [BR:npr03110]  Protein folding catalysts   Protein disulfide isomerase    108787622 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin OST3_OST6 Thioredoxin_9 Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 AhpC-TSA DIM1 TXD17-like_Trx DUF6568 Redoxin Motif Other DBs NCBI-GeneID:  108787622 NCBI-ProteinID:  XP_018412723 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MVRHIESLEEFKEALAGAGPKLVIVDFTATWCGPCKMIGPIFEALSQSHPDVVFLKVDVD DAQDVAQHCDIKCMPTFHFYKNGSKVHEFSGANKDSLLQKLLELK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtccgacacatcgagagtctggaagaattcaaggaagccctggctggtgctggaccc aaacttgtcattgtagactttactgctacatggtgtgggccatgcaaaatgattggacct atatttgaagctttgagtcaaagtcacccagatgttgtgtttcttaaggtggatgtggat gatgcacaggatgttgctcaacactgcgatatcaaatgcatgccaactttccatttctat aaaaatggatcaaaggtacatgaatttagtggagccaataaggatagcttgctgcagaag ctattggagctgaagtga

DBGET integrated database retrieval system