Nanorana parkeri (Xizang Plateau frog): 108789099 Help Entry 108789099         CDS       T04897                                  Symbol CENPS Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:npr00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     108789099 (CENPS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:npr03036]     108789099 (CENPS)    03400 DNA repair and recombination proteins [BR:npr03400]     108789099 (CENPS) Chromosome and associated proteins [BR:npr03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      108789099 (CENPS) DNA repair and recombination proteins [BR:npr03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      108789099 (CENPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C DegS Histone UPF0122 TFIID-31kDa Motif Other DBs NCBI-GeneID:  108789099 NCBI-ProteinID:  XP_018414531 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAEDAELRLQRIQRLKAAVHYTVGCLCQEVAEDKEIQFSKQAIAAISETTFRQCETFAKD LEMFARHGKRSTINVDDVKLLSRRSRSLHAHISSYSEEVASNNQEQKEKKRKKKSVVAGK GKRQSDGDSAMPDTEEPAME NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcggaggatgcggagctgagactccagcgcattcagcgtttgaaggcagccgttcac tacacagtgggatgtctctgtcaggaggtggcagaagacaaggaaatccagttcagcaaa caagccatcgctgcaatttctgagaccaccttccggcagtgtgaaacatttgcaaaagac cttgagatgtttgcgcggcatggaaaaagatccacaatcaatgtggacgacgtgaaactt ctttctcggcggagtcgatcgctgcatgcgcacatcagctcatacagtgaagaggtggct tccaacaaccaggagcagaaagagaagaagaggaagaagaaatcagtggtggctgggaag ggaaagaggcaatcggatggcgattctgcaatgccggacacagaggagccggccatggag tga

DBGET integrated database retrieval system