Nanorana parkeri (Xizang Plateau frog): 108789229 Help Entry 108789229         CDS       T04897                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04081   Hormone signaling npr04144   Endocytosis npr04150   mTOR signaling pathway npr04270   Vascular smooth muscle contraction npr04310   Wnt signaling pathway npr04350   TGF-beta signaling pathway npr04510   Focal adhesion npr04517   IgSF CAM signaling npr04520   Adherens junction npr04530   Tight junction npr04621   NOD-like receptor signaling pathway npr04625   C-type lectin receptor signaling pathway npr04810   Regulation of actin cytoskeleton npr05100   Bacterial invasion of epithelial cells npr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npr00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108789229    04350 TGF-beta signaling pathway     108789229    04150 mTOR signaling pathway     108789229   09133 Signaling molecules and interaction    04081 Hormone signaling     108789229    04517 IgSF CAM signaling     108789229  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108789229   09144 Cellular community - eukaryotes    04510 Focal adhesion     108789229    04520 Adherens junction     108789229    04530 Tight junction     108789229   09142 Cell motility    04810 Regulation of actin cytoskeleton     108789229  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108789229    04625 C-type lectin receptor signaling pathway     108789229   09153 Circulatory system    04270 Vascular smooth muscle contraction     108789229  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108789229    05100 Bacterial invasion of epithelial cells     108789229  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108789229   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108789229    04031 GTP-binding proteins [BR:npr04031]     108789229 Membrane trafficking [BR:npr04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     108789229 Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108789229   Exosomal proteins of other body fluids (saliva and urine)    108789229   Exosomal proteins of colorectal cancer cells    108789229   Exosomal proteins of bladder cancer cells    108789229 GTP-binding proteins [BR:npr04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     108789229 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  108789229 NCBI-ProteinID:  XP_018414691 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKNTCDLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccattcgtaaaaaacttgtgattgttggggatggagcttgtggaaagacctgt ctcctcatcgtcttcagcaaggaccagttccctgaagtctatgtgcccacagtgtttgag aattacgtcgcagacatcgaagttgattccaaacaggtggagctagccttgtgggataca gccggccaggaagactacgatcgcctccgacccctgtcttatcccgatacggatgttatt cttatgtgcttctccatagacagccctgatagcttggagaatatcccagagaagtggact ccagaggtgaaacatttctgccccaacgtgcctataatcctggtgggaaacaagaaggat ttaaggaatgatgaacacactcgtcgtgagctggctaaaatgaaacaggaaccagtgaag ccggaagaaggccgggacatggccaataggattggagcttttggctacctggaatgctct gccaaaacaaaggacggtgtgcgggaagtgtttgagatggcgacaagagctgctttacag gccaagcgagggcgcaagaaaaacacgtgcgatctgctttaa

DBGET integrated database retrieval system