Nanorana parkeri (Xizang Plateau frog): 108789544 Help Entry 108789544         CDS       T04897                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04068   FoxO signaling pathway npr04136   Autophagy - other npr04140   Autophagy - animal npr04621   NOD-like receptor signaling pathway npr04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:npr00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     108789544 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108789544 (ATG12)    04136 Autophagy - other     108789544 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     108789544 (ATG12)    04622 RIG-I-like receptor signaling pathway     108789544 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108789544 (ATG12)    04121 Ubiquitin system [BR:npr04121]     108789544 (ATG12)    03029 Mitochondrial biogenesis [BR:npr03029]     108789544 (ATG12) Membrane trafficking [BR:npr04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     108789544 (ATG12) Ubiquitin system [BR:npr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    108789544 (ATG12) Mitochondrial biogenesis [BR:npr03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     108789544 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  108789544 NCBI-ProteinID:  XP_018415087 LinkDB All DBs Position Unknown AA seq 128 aa AA seqDB search MEEGEEQQGLSPKDGSDTPSEPAPGPPVSPATEELSGEAKRKIDVLLKAVGDTPIMKNKK WTIEKTRTVQGLMDFIKKYLKMDSSEQLFIYVNQSFAPSPDQEVGILYECFGSDGKLVLH YCKSQAWG NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggaggaaggagaagaacagcaaggtttgtctccgaaggatgggagcgacacaccgagc gagccggcaccgggacctcctgtatccccggccacggaggagctttcgggagaggcgaaa cgaaaaattgatgtcctgctgaaggcggttggggacacgccaatcatgaaaaataaaaag tggactatcgagaaaacgcgcacagtgcaaggccttatggacttcatcaaaaaatacctc aagatggactcttcagagcagctgtttatctatgtgaatcagtcatttgccccatcacct gaccaagaagttggcatcctatatgagtgttttggaagtgatgggaaacttgttttacat tattgtaaatcacaagcctggggttga

DBGET integrated database retrieval system