Nanorana parkeri (Xizang Plateau frog): 108790460 Help Entry 108790460         CDS       T04897                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04137   Mitophagy - animal npr04140   Autophagy - animal npr04144   Endocytosis npr04145   Phagosome npr04148   Efferocytosis npr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108790460    04145 Phagosome     108790460    04140 Autophagy - animal     108790460    04137 Mitophagy - animal     108790460    04148 Efferocytosis     108790460  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108790460  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108790460   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108790460    04031 GTP-binding proteins [BR:npr04031]     108790460 Membrane trafficking [BR:npr04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108790460 Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108790460   Exosomal proteins of other body fluids (saliva and urine)    108790460   Exosomal proteins of colorectal cancer cells    108790460   Exosomal proteins of bladder cancer cells    108790460 GTP-binding proteins [BR:npr04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108790460 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU ATP_bind_1 FeoB_N AAA_7 AAA_16 cobW MCM G-alpha AAA_22 AAA AAA_29 AAA_5 DAP3 Septin AAA_24 AIG1 Podovirus_Gp16 Motif Other DBs NCBI-GeneID:  108790460 NCBI-ProteinID:  XP_018416221 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MFSRQHIKILLIGNAGVGKSALMNQYVNSRFTNYYRATIGADFFTKELRLDDRMVTAQIW DTAGTERFQSLGAALYRGTDCCLLVFDVTSPNSFHALDTWHKEFLVQADPSSPDKFPFVV IANKADLEERQVTPRQAQEWCKSCNAEYFETSAKEAMNVEEAFLEAIRLAIKHHDVPIQK ANGESVTLLEKEENPRKNKCDC NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgttctcaagacaacatatcaaaattcttttaattggaaatgcgggagtgggaaagtcg gcgctgatgaaccagtatgtcaacagtcgtttcaccaactactacagagccaccataggg gcagacttcttcaccaaggagctacgattagatgacagaatggtgacggcacagatttgg gatacagccggcacagaacgctttcagtctctgggcgcagcactttacaggggcacagac tgttgtttgctggtctttgatgtgacgtctcctaattccttccacgctcttgacacctgg cataaagaattcctggtacaagctgatccttcatctccagacaaatttccctttgtggtg attgccaacaaggcagatctcgaggaacgtcaggttactcctcgtcaggcacaggagtgg tgcaagtcgtgtaatgcagaatactttgaaaccagtgcaaaggaagcaatgaacgtagag gaagcatttttggaagccatcagactagccatcaagcatcatgacgttccgatccaaaag gccaacggagaatctgtgactttgttagaaaaggaagaaaatccacgcaaaaataaatgt gactgttaa

DBGET integrated database retrieval system