Nanorana parkeri (Xizang Plateau frog): 108795656 Help Entry 108795656         CDS       T04897                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04010   MAPK signaling pathway npr04020   Calcium signaling pathway npr04114   Oocyte meiosis npr04218   Cellular senescence npr04310   Wnt signaling pathway npr04370   VEGF signaling pathway npr04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:npr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     108795656 (PPP3R1)    04310 Wnt signaling pathway     108795656 (PPP3R1)    04370 VEGF signaling pathway     108795656 (PPP3R1)    04020 Calcium signaling pathway     108795656 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     108795656 (PPP3R1)    04218 Cellular senescence     108795656 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     108795656 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:npr01009]     108795656 (PPP3R1) Protein phosphatases and associated proteins [BR:npr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108795656 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  108795656 NCBI-ProteinID:  XP_018422448 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagctacccgttggaaatgtgctcacatttcgatgctgatgagatc aaaaggctaggaaagagatttaagaaacttgacttggacaactcgggatctctgagtgtg gaggaattcatgtctttacctgagctccaacagaaccctctcgtgcagcgagtaatagac atatttgacaccgatgggaacggagaggtagactttaaagaatttatcgaaggagtttct cagttcagcgtaaagggtgacaaggaacagaaactgaggtttgctttccgtatatatgac atggacaaggatggctatatctcaaacggcgagcttttccaggtgttgaagatgatggtc ggaaacaaccttaaggacacacagttacagcaaatagtagacaaaacgattatcaatgca gataaagatggcgatgggagaatatcttttgaagaattctgtgctgtcgtaggtggttta gatatccacaaaaagatggtggtcgatgtgtga

DBGET integrated database retrieval system