Nanorana parkeri (Xizang Plateau frog): 108796837 Help Entry 108796837         CDS       T04897                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr04810   Regulation of actin cytoskeleton npr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:npr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     108796837 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108796837 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:npr04131]     108796837 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:npr04812]     108796837 (PFN2)    04147 Exosome [BR:npr04147]     108796837 (PFN2) Membrane trafficking [BR:npr04131]  Others   Actin-binding proteins    Others     108796837 (PFN2) Cytoskeleton proteins [BR:npr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      108796837 (PFN2) Exosome [BR:npr04147]  Exosomal proteins   Proteins found in most exosomes    108796837 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  108796837 NCBI-ProteinID:  XP_018423878 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MSGWQDYVDMLMADGSCQEAAIVGYVDAKYVWATTPGGFFQTLTPAEIDVLIGKDREGFF TNGLTVGGKKCSVIRDSLYIENDYTMDIRTKSQGGEPTYNIAVGRAVRVLVFAMGKEGVH GGGLNKKAFAMVKYLRDMGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgtccggctggcaggattacgtggatatgctgatggccgatggcagctgccaggaggcc gccattgtcggttacgtggacgccaaatacgtctgggcaacaacccccgggggcttcttt cagaccttgacgcctgcagaaatcgatgttctgataggaaaggacagagaaggattcttc actaatggtctaactgttggaggaaagaaatgctcggtgatcagagacagcctgtatatt gaaaatgattacacaatggatatcaggacaaaaagtcaaggcggagaaccaacatacaac attgctgtagggagagctgtcagagtcttggtcttcgcaatgggcaaagaaggagtccac ggaggcggcttgaataaaaaggcattcgcaatggtgaaatacttgagagatatgggattc tag

DBGET integrated database retrieval system